KEGG   Aspergillus niger: ANI_1_2010184
Entry
ANI_1_2010184     CDS       T01030                                 

Gene name
An04g06990
Definition
(RefSeq) glycosyl hydrolase family 47 protein
  KO
K01230  mannosyl-oligosaccharide alpha-1,2-mannosidase [EC:3.2.1.113]
Organism
ang  Aspergillus niger
Pathway
ang00510  N-Glycan biosynthesis
ang00513  Various types of N-glycan biosynthesis
ang01100  Metabolic pathways
ang04141  Protein processing in endoplasmic reticulum
Module
ang_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    ANI_1_2010184 (An04g06990)
   00513 Various types of N-glycan biosynthesis
    ANI_1_2010184 (An04g06990)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ANI_1_2010184 (An04g06990)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ang04131]
    ANI_1_2010184 (An04g06990)
Enzymes [BR:ang01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.113  mannosyl-oligosaccharide 1,2-alpha-mannosidase
     ANI_1_2010184 (An04g06990)
Membrane trafficking [BR:ang04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   ER-Golgi intermediate compartment (ERGIC) proteins
    ANI_1_2010184 (An04g06990)
SSDB
Motif
Pfam: Glyco_hydro_47
Other DBs
NCBI-GeneID: 4991103
NCBI-ProteinID: XP_001402060
UniProt: A2QJG4
AA seq 579 aa
MARRSYLLPTIILLCITYALFSSLPPGAEPHYHHHFRNPYDPPPHKEGRIRWRKHAEQYP
ISDYIPLPSTEPSTIPRIQHKFPRESWFARWGRVKRQRAVKKAFQHAWKGYRNNAWLEDE
LSPISGGHRETFAGWAATLVDSLDTLVIMGLTEEFEEAVKALEYIDFTTTSAIQINVFET
NIRYLGGLLGAYDLTQGKYPILLKKAVEIADMIYGSFDTRNRMPQSRWEWTRSADGLSIE
PGRNTILAELGSLNLEFTRLSQLTKDPKYFDAIQRIADFLEDTQETTDVPGMWPMMVNAK
DLEFADPRFTIGGMADSTYEYLPKEHMLLGGQTNQYRRMYNSFMKAMKSRLLFRPMTEDG
RDILFAGNLRVTGSSTRSNLEPQWEHLKCYLGGTVGIGSKVFDRPEDLAVARKLVDGCIW
AYDIMPTGIMPEILHLTVCKDDENCQLPQSSHPTSTSKDGKKLPPGVVDIPDPKYLLRPE
AIESVFIMYRITGDRSLQDAAWRMFQNIDKMTRTSFGHAAISDVRDPESPQMDYMESFWL
AETLKYFYLIFSEPDLVNLDEYVLNTEAHPFKRPTASST
NT seq 1740 nt   +upstreamnt  +downstreamnt
atggcgcgacggagctacctcctacccactatcattctcctatgcatcacatacgctctt
ttctcgagtctaccgcccggtgcggaaccacactaccaccaccatttcagaaatccatac
gacccccctccacataaagagggtaggattcgttggcggaaacatgccgagcagtatcca
atctccgattacatcccccttccttcgactgagccatccactattccccgaattcagcac
aaatttcctagggagtcgtggttcgcacgatggggacgggtaaaaaggcagcgtgcggtc
aagaaggcattccagcacgcgtggaaaggatacaggaacaatgcctggctggaagacgag
ctctctcccatcagtggcggtcaccgcgagacctttgcaggctgggcagctaccttggtg
gattccctagatactcttgttattatgggactcactgaggaatttgaggaggctgtgaaa
gcgctggagtacatcgacttcactaccaccagcgccattcaaattaatgtcttcgagacc
aatatccggtacttgggcgggcttcttggtgcctacgacttgacccagggaaaatatccg
attctcctgaagaaggcagttgagattgcggacatgatttatggttcttttgacactcgt
aatcggatgccgcaatctcggtgggaatggaccagatctgcggatggtctgagcatcgag
ccgggccgaaacaccatacttgctgaactcggatcattgaacctagaattcacgcgtcta
tctcaacttacaaaggaccccaaatactttgatgctatccagaggatagcggattttctc
gaggatactcaggagacaaccgacgtacctgggatgtggcccatgatggtcaatgctaag
gacttggaattcgctgatcccaggttcaccatcggtggaatggctgactcgacatatgag
tacctcccgaaagagcacatgctgctgggagggcagacgaaccagtaccgtagaatgtac
aactccttcatgaaggcgatgaagagccgcctgcttttccgcccgatgaccgaagacggc
cgagatattctctttgctgggaacctccgcgttactgggtcttctacccggagtaacctg
gagccccagtgggaacatcttaagtgctaccttggaggtactgtcggcataggatccaag
gtgtttgaccgacccgaagatttggctgtcgcgcggaagttggtcgatgggtgcatttgg
gcatatgatattatgccgaccgggatcatgccagagatcttgcatcttaccgtgtgtaag
gacgatgagaattgccagttacctcaaagctctcatcccacaagcacctcaaaggatggc
aagaaactgccgccaggcgtagttgatattcccgaccccaagtatctactacgacccgaa
gctattgagtcggttttcataatgtaccgtataacgggggaccggtctctgcaggatgct
gcgtggaggatgtttcaaaatatcgacaagatgacgcggacctcatttggacacgcagcc
atttccgatgtccgggaccccgagtcgccgcaaatggactacatggaaagtttctggctg
gcagagactctaaagtacttttatctcatattttccgagccggacctcgtgaatctggac
gaatatgtgctgaacacggaagcgcatcccttcaagcgtccaactgcttcaagtacataa

DBGET integrated database retrieval system