KEGG   Aspergillus niger: ANI_1_134064
Entry
ANI_1_134064      CDS       T01030                                 

Gene name
An07g01100
Definition
(RefSeq) glutathione S-transferase
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
ang  Aspergillus niger
Pathway
ang00480  Glutathione metabolism
ang01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ANI_1_134064 (An07g01100)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ang02000]
    ANI_1_134064 (An07g01100)
Enzymes [BR:ang01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ANI_1_134064 (An07g01100)
Transporters [BR:ang02000]
 Other transporters
  Pores ion channels [TC:1]
   ANI_1_134064 (An07g01100)
SSDB
Motif
Pfam: GST_N_3 GST_N_2 GST_N Glutaredoxin GST_C_2 GST_C_5
Other DBs
NCBI-GeneID: 4981379
NCBI-ProteinID: XP_001391200
UniProt: A2QM77
AA seq 238 aa
MSSPKIVLYTNRTCPWAHRAHIVLQELGLPFQEVTIDLDTPREPWYLEVNPRGLVPSLSY
NGEVITESGIVAQFLADAYPSHLVPPSNTPEGALQRARIAFFVDTYSSKAAPHYNAALRG
ATEADRKAGVESYVAAIKKEIEPLLYQGLEGKQHGPFFGGSDKLTLVEVLLGSFLIRLHA
FADKEADLIDPAIWEGLAEAKNFSRWAQATREHPSVNGIFDAKACADRTKKKLLANRK
NT seq 717 nt   +upstreamnt  +downstreamnt
atgtcttctcccaagatcgtcctctacaccaaccgcacctgcccctgggctcaccgcgcc
cacattgttctccaggagctcggtctccccttccaagaggtcaccattgatttggatacc
ccacgcgagccatggtatctggaagttaacccgcgtggtctcgttccctccctctcctac
aatggtgaagtgatcaccgaatccggcatcgtcgctcaattcctcgccgacgcgtacccc
tcccacctcgtgcccccgtcaaacactcccgagggagctctgcagcgcgcccgcatcgcc
ttctttgtcgacacttactccagcaaagctgccccccactacaatgccgccctgcgtggt
gctaccgaagccgaccggaaggccggcgttgagagctacgtagctgctatcaagaaggag
atcgagcccctcctgtaccagggactggagggaaagcagcacggtcctttcttcggtggc
agcgataaattgactttggtggaggtgctgctcggatcgttcctgatccgtctgcacgcc
ttcgcggacaaggaggctgacttgatcgacccggccatctgggagggattggcggaggcg
aagaacttcagccgttgggcgcaggcgactcgggagcatcctagcgtcaatggtatcttt
gatgctaaggcatgtgctgacaggacgaagaagaagctcttggcgaacaggaagtag

DBGET integrated database retrieval system