KEGG   Aspergillus niger: ANI_1_1094064
Entry
ANI_1_1094064     CDS       T01030                                 

Gene name
An07g08830
Definition
(RefSeq) ENTH domain protein
  KO
K20044  phosphatidylinositol-binding clathrin assembly protein
Organism
ang  Aspergillus niger
Brite
KEGG Orthology (KO) [BR:ang00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ang04131]
    ANI_1_1094064 (An07g08830)
Membrane trafficking [BR:ang04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    ANI_1_1094064 (An07g08830)
SSDB
Motif
Pfam: ANTH ENTH
Other DBs
NCBI-GeneID: 4982151
NCBI-ProteinID: XP_001391957
UniProt: A2QPB1
AA seq 613 aa
MSQNFEKSVKGATKIKLAAPKSKYIEHILVATHTGEAGVAEIFRTLQLRLRDSTWTIVFK
ALIVVHLMIREGQLDATLQYMAENPRRLAISGFSEVQSQGHNIRRYSDYLIARARAFEDT
KTDYVRSGQGRMKRLTVEKGLLRETEIVQHQIHALLKCDLLTDDVENEISLTAFRLLVLD
LLTLYSVMNEGTINVLEHYFEMSRPDSERALEIYKTFTAQTEEVVKFLGVARHFQAATRL
EIPKLKHASTDLTRLLEDDLNDPDFNLRRREYLARKQGKSGGTPPPVSKTATGDRAVSNS
NTMPARPQTQPNPQTQKSNQSDLIDFFDSIEQNQQPMAQTNPFQQAQLQQQPQAMQFQQT
GFPPQQQAFYAQPTGFQQPQPTGFDQQAAFGNQFAPQNIQQFGQQQQAPQPLQPNHTGAG
FGGYSAQPQTYGFQSNLAPIPQHDMSAFSQQQQMPMAQQQLQPQSTNPFRQSMLMSTPTG
SATPATPLNRQNTNPFARRLSTVNPQVETGVPQAFPQAQPQAPQQPAPLQAQRTGTNPFA
RASSVPPPQSQGLQPPAAAPLRPNPTGSTNPFRQSAFVNQQTGQGWHVGGQQGTMGGLEQ
LDTVPIFPRPGLS
NT seq 1842 nt   +upstreamnt  +downstreamnt
atgtctcaaaattttgagaagtcggtgaagggagccaccaagataaagcttgcggccccc
aaatccaaatacattgaacatattcttgttgcgacacatacaggcgaggcaggtgttgca
gagatttttcggacgctgcagcttcgacttcgcgactcaacatggaccattgttttcaaa
gctcttattgttgtccacttaatgataagggaaggacagctggacgctacattgcagtat
atggcagagaaccccagaagacttgcgatcagtggattctcagaagtacaatcgcaaggc
cataatattcgaagatattccgattatctgatcgcgcgtgcgcgtgccttcgaggataca
aagaccgactatgtgcgaagcggacaaggtcgaatgaagagactgacagtagaaaaggga
cttctgagggagacggaaatagttcaacatcagatccatgcactgctcaaatgtgacctt
ctcactgacgacgtcgagaacgaaatatcgttgaccgcatttcgcttactggttttggat
cttctgacattgtattcagtgatgaatgaaggaacaataaacgttcttgagcattatttt
gaaatgtcgcgacccgacagcgaacgtgcattggaaatatacaagacatttactgcccaa
acggaagaagttgtgaagtttctgggagttgccaggcatttccaggctgcgacgcgattg
gagatccccaagctcaaacatgcttctacggatctgacgcgacttctggaggacgatctc
aatgacccggatttcaaccttcgccggcgcgaatatttggcacgaaagcaagggaagagc
ggcggaactcctccgcctgtgagtaaaactgcgacaggcgatcgggccgtgagcaactcg
aacactatgccggcccggcctcaaacccagccgaacccacagacacagaagtcaaaccaa
tcggaccttatcgacttctttgattcaatcgagcagaatcagcagccgatggcccagacc
aatccgttccagcaagcgcaattacagcagcaaccacaggcgatgcagttccagcaaacc
ggatttccaccgcagcagcaggccttctacgcgcaaccgacgggcttccagcagccccaa
cccactgggtttgaccaacaagcggcgtttggaaaccaatttgcgccgcagaatatccag
cagtttggccagcagcagcaggccccccaacctcttcaacccaaccacacgggggctgga
tttggtggttattcggcgcagccccagacatacgggttccagtcaaacctcgcacccatc
ccacaacatgacatgagcgcattctcccagcagcaacaaatgccaatggcccagcagcaa
ttgcagccacagtcaaccaaccccttcagacaatcaatgttaatgagcacgccgaccgga
tcggccacgcctgccaccccccttaaccgccaaaatacgaaccccttcgcacgacgttta
tcaacagtcaaccctcaggtcgaaaccggtgtccctcaagccttcccgcaggcgcagccg
caagcgccccaacagccagcgccacttcaagctcagcgaacgggaaccaatccgtttgcc
cgtgcgtcctctgttcccccaccgcagtcacagggcctgcaacctccagctgcggctcct
ctgcgaccaaaccctacagggagcacgaatcctttccgtcagagcgcctttgtgaaccag
cagacaggtcaagggtggcatgtcggtggacaacagggcacaatgggaggtttggagcaa
ctggacactgtgccaatcttcccgcgcccggggctatcatag

DBGET integrated database retrieval system