KEGG   Aspergillus niger: ANI_1_274094
Entry
ANI_1_274094      CDS       T01030                                 

Gene name
An11g01990
Definition
(RefSeq) hypothetical protein
Organism
ang  Aspergillus niger
SSDB
Other DBs
NCBI-GeneID: 4984428
NCBI-ProteinID: XP_001394203
UniProt: A2QVM9
AA seq 665 aa
MACRPHGLSRTLPKNFTFSSSGEPRTPERVSHHLDVPPPPPRHSSCRLRRSRVRSGTDVF
AQAEYDLSTFNPNPSDVPIPSIEVPSYDAFAGPSCPAVPSRDDRFLAPPRDRLAMKTPPA
QIRPDPIEDNNTASWSLEDPQALGESIQRPSSVCSQASDSSVSSIETFSSRRSAGGSCTS
MESDSYDPFFHLELPPKPAPETPSLCRTRNKNKARMLHAKERWTLDMDNHLWNTYQLYIQ
DPTITPFKMTPGSIPPLGVTHRVAREAKRTWERRRFRLDRQFPFALSYQRPSSNSTPTPK
VDAVKPTWPKSEASTRRRLKLLCRKKFSIAPHYQRMMQSRSPTPFLDLLSQPSAEPSRAV
GPTNSCTAYATRDLGVSLVSSSVPGPLAQLAAEDSSPPMSNEWFNNPILSAPRQLIPEPP
TIHPGTAPRLEPVPRLGSPFTYNTWGPNASRKRPQRHTPRARRETIHVTGSRLRSPPRME
PFPNVDHHQHLAPYVATTSESPAEQDTRVQLEDLVRQGKLNDLGQHRIRIRNRGATISSV
NHKGLDQLFSPPSSSSRNDEDTMVGKPIVNPMLNLSGDSIKRLGSPFKVETPKRAQPSPR
RIRHAPSLSDPFASGLIPTFQPTSPNSQSKNEEMASRLPYDPTEQGISDAERIRRQILNM
PYSRQ
NT seq 1998 nt   +upstreamnt  +downstreamnt
atggcttgtcgaccacacggcctatcgcgcaccctgccgaagaacttcaccttttcttcg
tcgggcgagcctcgcacaccggagcgcgtctcacatcacctggatgtgccgccgcctccc
cctcgtcattccagttgccgcttacgtaggtcccgcgtccgctcggggaccgatgtcttt
gcgcaggccgaatatgacctcagcacgttcaaccccaacccatccgatgtccctatcccc
tcgattgaagtcccttcttacgacgcttttgcgggcccctcgtgtccagcagtaccctcc
cgtgatgaccgttttttagcgccgccccgggatcgcctggccatgaaaacacctccggct
cagattcgccccgacccgatcgaggataacaataccgcatcgtggtctctggaggacccg
caggctctgggagagagtattcaacgtcctagttccgtctgctcacaagcatcggactcg
tccgtctcctcgatagaaacgtttagctcccggcgctcggcgggtggaagctgtaccagc
atggagagcgactcatacgacccattcttccacctggagcttccaccaaaacctgcgcct
gagacgccctctctgtgtcgaacgcgcaataagaacaaggcacggatgctgcacgccaag
gaacgttggaccctggacatggacaaccatctatggaatacttaccagctctacatccaa
gaccctaccatcacccctttcaaaatgactccgggcagcattccgccacttggagtcact
caccgtgttgcccgagaggccaagcggacgtgggagagaaggcgctttagactcgaccga
cagtttcccttcgcgctctcctaccaacgtccatctagcaactcgactcccactcccaag
gttgatgcggtgaagcctacctggcctaaatcagaagcctcgacgcggcgcaggctaaaa
ctactgtgtagaaagaagttttcgattgctcctcactaccagagaatgatgcaatctcgg
agcccgacgccgttcctggacttgctgtcccagccgtctgcagaaccttccagggctgtg
ggccctaccaatagctgcacggcctatgcgacgcgcgatctgggtgtgtctctcgtttcc
agctccgtacctgggcctctggctcagctggcagcggaagactcttcgcctccgatgagc
aacgaatggttcaacaatcccatactcagtgcgcctcgccaactcatcccagagccacct
acaatacaccctggtactgcccctagactagagcccgtgccacgactaggatcgccattt
acgtataacacctggggtcccaatgcctcgagaaagcgacctcagcgtcatacccctagg
gctcggcgagaaacaatccatgtgacgggctcccggctacgttctccgccccgtatggag
ccatttccgaacgtcgaccatcatcaacacctggctccttatgtggccactaccagcgaa
tcgccagcggaacaagatacgcgggtgcagctagaagaccttgtccgtcaaggaaagctc
aatgatttaggtcagcaccgcatacgcattcgcaaccgtggagccacgataagttcagtg
aaccacaaaggcctcgaccagttgttctccccaccgtcgtcgtcctctcgaaacgacgaa
gataccatggtcggaaagcccatcgtcaatcctatgttgaatctcagtggcgacagtatc
aagcgtttgggctcccccttcaaggtagaaacccccaaacgagcccagccgtcgcctagg
cgcattcgccacgcgccgtcgctctcggatcccttcgcaagcggtcttataccaacattc
cagccgacgagtcccaacagtcaatcgaagaacgaagaaatggctagtcggctcccgtac
gatccgacggagcaaggcatctccgatgcagagcgcattcgaaggcaaatcctgaacatg
ccgtactcgaggcaatag

DBGET integrated database retrieval system