KEGG   Aspergillus niger: ANI_1_2462094
Entry
ANI_1_2462094     CDS       T01030                                 

Gene name
An11g09350
Definition
(RefSeq) NADH-ubiquinone oxidoreductase subunit
  KO
K03885  NADH:ubiquinone reductase (H+-translocating) [EC:7.1.1.2]
Organism
ang  Aspergillus niger
Pathway
ang00190  Oxidative phosphorylation
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ANI_1_2462094 (An11g09350)
Enzymes [BR:ang01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     ANI_1_2462094 (An11g09350)
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6
Other DBs
NCBI-GeneID: 4985151
NCBI-ProteinID: XP_001394893
AA seq 689 aa
MSAALLRSRPDPHALKRIALLSRRYQSSKSPASAGLAASRTRLPHRTATAQCLASRAFFN
SQYSVRHNSTTPEASEPTRRSSFRNAVFKSFAYCGFFIVMSGAAVVAFFIYDATTYRENS
SAEDIPVSELALNPRRGGPKNLPIAEVLLGDSDSEAKLEQKDKPRLVILGTGWGSIALLK
HLNPGDYHVTVVSPTNYFLFTPMLPSATVGTLGLRSLVEPVRRIVQRVHGHFLKGEAQDV
DFSEKLVEVSQLDANGQEQRFYLPYDKLVIGVGCVTNPHGVKGLDNCHFLKSIDDARKIK
NKVLENMELACLPTTSDEERKRLLSFVVCGGGPTGVEFAAELFDLLNEDLLYSFPKILRN
EISVHIIQSRSHILNTYDEALSRYAESRFARDHVDVLTNARVAEVRDDRVLFTQEEDGKR
ILKEIPMGFCLWSTGVARADLCKRLSDKLESQNNKHALETDSHLRLIGAPLGDVYAIGDC
STVQNNLAGNIMSFLRTIAWEKGKDPEKLHLTFREWREVATRIRKRFPQASNYLRRLDKL
FEQYDKDQSGTLEFGELSELLHQIDTKLTSLPATAQRANQQGEYLGRKLTKIAAALPGMQ
ANQIDYGDLDEACYKAFKYKHLGSLAYISNAAIFDFGGLNFSGGVLAMYLWRSVYFAESV
SFRTRCMLAMDWAKRSLFGRGKFLYLMSF
NT seq 2070 nt   +upstreamnt  +downstreamnt
atgagcgcggcgctgctccggagtcgtccggacccccatgccctgaaaagaatcgccctt
ttatcacgtcggtatcagtcctcgaagtctccagcatcagcaggcctcgcggcatcccga
acccggttaccccatcgcactgcgacagctcaatgcttggcgtcgcgtgcctttttcaac
tcccaatactccgtccggcataattctacaacccctgaagccagcgaacctacgcggaga
tcctccttccgcaatgccgtcttcaagtcctttgcctattgcggcttcttcattgtcatg
agcggtgctgccgtcgtggcgttcttcatctacgatgcaaccacttaccgcgaaaactcg
agtgcggaggacatccccgtttcggaattggcgctgaatccccggcgcggtggacctaag
aacctccccattgcggaggtcttgcttggagacagtgattcagaggctaagctggagcag
aaggacaagccccgcctggtcatcctgggtacgggttggggtagcatcgcgcttctgaaa
catctcaaccccggcgactaccatgtcacggtcgtgtcccctaccaactacttcctgttc
actccgatgctgccgtctgcgacggtgggaactttgggtttgaggtcgcttgtcgagcct
gttcgtcggatcgtgcagcgggtgcatggccatttcctcaagggagaggctcaggacgtt
gacttttccgagaagttggtcgaggtatctcaactcgatgccaatggccaggagcagagg
ttctatctgccttatgataagctagtcatcggtgtcggttgtgtaaccaacccccacggc
gttaagggactggacaactgccacttcctgaagtcgatcgatgatgcccggaagattaag
aataaggttttggagaacatggagcttgcctgcctgcctacgaccagtgacgaggagcgt
aagcgacttttgtccttcgttgtctgcggtggcggcccgactggcgttgagttcgctgcg
gagctgttcgatctgctcaacgaggaccttctttactccttccctaagatccttcggaat
gagatttccgtgcacatcatccagagccgtagtcacattctaaacacctacgacgaagcg
ctctctcgctatgctgagtcccgtttcgctcgcgaccacgtcgacgtcttgacgaacgcc
agagtggcggaggtccgcgacgaccgagtcctcttcacgcaagaggaagacggtaagcgc
atcctgaaggagatccccatgggcttctgcctgtggtccactggtgtcgcccgcgccgat
ctctgcaagcgcctctccgacaagcttgaatcccaaaacaacaagcatgccctcgaaaca
gactcccaccttcgtctcatcggcgcgcccctcggcgatgtctacgcaattggcgactgc
tctaccgtccagaacaatctcgccggcaacatcatgtccttcctgcgcaccatcgcctgg
gagaagggcaaggaccccgagaagctgcacctgaccttccgcgaatggcgcgaagtagca
acccgcatccgcaagcgtttccctcaagcctcgaactacctccgccgccttgacaagctc
ttcgagcaatacgacaaggaccagtccggtacgcttgagtttggcgaactctctgagctc
ctgcatcaaatcgacacgaagctcacttccctgcctgctaccgcgcagcgcgcaaaccag
cagggcgagtacctgggccgtaagctgaccaagattgcggcagcgctgccgggtatgcag
gccaaccagatcgactatggagatctggatgaggcgtgctacaaggctttcaagtacaag
cacttgggaagtttggcgtacatcagcaatgctgctatctttgactttggcggtttgaac
tttagcggtggtgtcctggcgatgtacctctggcgtagtgtttactttgccgagagcgtt
agcttcagaacgaggtgtatgctggccatggattgggccaaacggtcgttgtttgggaga
ggtaagtttctgtatctcatgagcttttaa

DBGET integrated database retrieval system