KEGG   Aspergillus niger: ANI_1_1894104
Entry
ANI_1_1894104     CDS       T01030                                 

Gene name
An12g05680
Definition
(RefSeq) hypothetical protein
  KO
K21440  ankyrin repeat domain-containing protein 50
Organism
ang  Aspergillus niger
Brite
KEGG Orthology (KO) [BR:ang00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ang04131]
    ANI_1_1894104 (An12g05680)
Membrane trafficking [BR:ang04131]
 Protein recycling
  Others
   Others
    ANI_1_1894104 (An12g05680)
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5 NACHT_N NACHT AAA_16 RNA_helicase
Other DBs
NCBI-GeneID: 4985918
NCBI-ProteinID: XP_001395633
AA seq 1139 aa
MTASIEILQSDYDLKFQPVDSSLHERLSDFLKTRANLVEEKKWMIHLGTHTIIVRDQLTK
AFQNILAVKDIVTTAANASLPASLACAGIMACFTTVIQAAEQHSHLLQGLESISELICRL
HVMERLYLHSDTKQNIGLLDDLRKTMISFYSKILEFQARALCYLHRPRAYQFWRDVLNRD
GWANLLQEFERYQITLGRTTSVIADAGSMQRYEELQDKYKRILEALHNRNIWTATSDRDE
KVKRFLNLLYTCPYKDRKDRNSKRVLGTCEWFIGHEKFHAWQGSSGNGLSSLLWVSADPG
CGKSVLTRYLVDEVLVSNDKRTVCYFFFKDDFTDQKSATSALSVILRQLFIAQPHLLHDA
ILDKADTDSSKLTQSFSELWSILMSVSTDPKAAEIYCLLDALDECHDEDRSRLINAVNDF
YANTHKNSKLKFLITSRPYEHIRRGFSPLITESPTIHLSGDDGEEAEQISHEINLVIRKR
VQDISKQRSLMKEECTMLIDRLTAVQNRTYLWVSLILDVLENTPEFSKGKVHRILSDLPT
TVDCAYERILDRSPDKEKAKITLHIITAAMRPLSLEELSLALALSAGYQAPTDIVDNMEP
THRFKKTLRDLCGLFVIILDDKVYLLHQTAKEFLVRDNNSILDKTLSQPTTGWKYSLLPG
ESNRILAGICISCISLDPENFPQKCMLEYSSSYWDTHFRQACIPDEDPLIDRAKLLCEPW
SDIFQTWSRIYAVKTDNIPDSTSSLLIASSMGLIGVVKSILPTGKANLNSKDSDYDQTPL
SWAAERGHVAVVKLLLAAEEVDIDSRNSIGRSPLSLAAQNGHDEVVKLLIREDVDIDSKD
VPGSTPLALAAENGHERIVRLLLATGKADIDSRDSSGNSPLSLAAQFGHEAVVKIVLATG
EVDVNNKDSRGKTPISWAAREGYEAVVRRLLDTGKVEVDCKDSDNGTPLLLAAIEGCEGI
VKRLLATGQVDVNIRDRRYGREPLSWAAGEGHEAVVKLLLSTREVDVDVRDPRYGRSPLS
WAAGEGHEEVVELLLATGKVDVESKSIRGRTPLSWAAWEGHDIVVKLLLATGEVVVNSRD
SEGRTPLSWAAENGNEAVIKLLIATGNADVSARDVNGRTPQDWAAEYDHQSVVKIFRMC
NT seq 3420 nt   +upstreamnt  +downstreamnt
atgacagcctccattgaaatactgcagtccgattatgatttgaaatttcaaccagtggat
tcgtccctccatgagcgactatctgactttcttaagaccagggcgaatctggtggaggag
aagaagtggatgatacacctaggaacccataccatcatcgtccgggaccaacttaccaag
gcgttccaaaacatcctggcagtgaaagatattgtgactactgcggcaaatgcaagtctc
ccagcctcacttgcctgtgctggaataatggcctgctttacgacggtcatccaagcagca
gagcagcattcccatctcctgcaaggattagaatctatttctgagttaatttgccgattg
catgtaatggagcgcctttatctgcactcggacacaaaacagaacattggcctccttgat
gaccttcggaaaactatgatttcattttactcaaagatactggaattccaggcccgagcg
ctctgctatttacacagacctcgagcataccaattctggagagatgtccttaaccgcgac
ggctgggctaacctgctgcaagaatttgagagataccagatcacactaggtcgaactact
tccgttattgcagatgcaggatcaatgcaaagatacgaagagcttcaggacaagtacaaa
agaatattggaggccttacacaatcgcaacatatggacagctacatccgatcgagatgag
aaggtgaaacgattcctcaacctgctctacacctgtccctataaggaccgaaaagaccga
aacagcaagcgtgtccttggaacctgtgaatggttcatagggcatgagaaattccatgcc
tggcaagggagttcaggaaatggcctctcaagtctactatgggtgtcggctgatccagga
tgtggcaagtcagtcttaactcgatatctggtggatgaggttcttgtcagcaatgataag
cgaacagtctgctatttcttctttaaagatgactttaccgaccagaagagcgcaacaagc
gcgctttcagtcatattaaggcagctattcatagcgcagcctcaccttttgcacgacgca
atactggataaagcggacactgacagtagcaagcttactcagtcattctcagagctgtgg
agtatactcatgtctgtttcgaccgatccaaaggcggcagaaatatattgtctccttgat
gccttagacgaatgccatgacgaggaccggagccggctcatcaacgctgtcaacgacttt
tatgcaaacacccacaagaatagcaaactgaagttcttgattacaagtagaccatatgag
catatacggcgtggattctcccctcttatcacagaatcacccaccatccacttaagtggt
gacgacggggaagaggctgagcagatatctcatgaaataaatcttgtcatccgaaaaaga
gtgcaggacatcagcaagcaaagatcgctgatgaaggaggaatgcacaatgctcatagac
aggcttactgcggttcaaaatcgaacttatctgtgggtgagtctgatattagatgtcctc
gagaataccccggagttctcaaaaggtaaagtccatcggatactgagtgacctacccacc
accgttgactgtgcctatgagagaatcttggatcgaagtccagataaggaaaaggctaag
ataactctccatattattacggcagctatgcgacctctttccttggaagaactatctctg
gccctagcactcagcgcaggctatcaagccccaacagatatagttgataacatggagcca
acgcatcgcttcaaaaagaccctaagagacctttgcgggctctttgtgatcattctggat
gacaaggtctatcttctgcatcagacggcgaaagagtttttggttcgggacaacaactct
atcctggacaaaaccctctcccaacccacaacagggtggaagtattcactccttccaggt
gaatcgaaccggatccttgcgggaatatgcatttcctgtatatctcttgatccagaaaac
tttcctcagaaatgtatgctagagtactcatcatcttactgggacactcatttccgtcaa
gcttgcattccagacgaagacccgctaatagaccgcgcgaagttactttgcgaaccatgg
tcggatatatttcaaacatggtcgaggatttatgctgtcaaaacagataatattcctgac
agcacttcatcacttttgattgcatcatccatggggcttatcggcgtggttaagtccatt
cttcctacaggaaaagcaaaccttaactcaaaggattcggattacgatcagacaccatta
tcatgggcagcggaacgtggccacgtggcagttgtgaagcttctgcttgccgcagaggaa
gtggacatcgactcgaggaactcaattggccgaagcccactgtcattagcagctcagaat
ggtcacgacgaagtggtgaagctcctaatccgtgaagatgtggacatcgattcgaaggat
gtgcctggcagtacgccgctagcactggcagctgagaatggccacgagagaatagttcgc
cttctacttgctacaggaaaggccgacatcgactccagagattcatctggaaatagtccc
ctgtcgttggcagcacagtttggccacgaggcagtggtaaaaatcgtccttgctactgga
gaggttgatgtcaataacaaggattcaaggggcaagaccccaatatcctgggcagcaagg
gaaggctacgaagcagtagtaaggcgccttctcgatacaggaaaggtagaagttgactgc
aaggactccgataacggtactcctctgcttttggcagcaatagaaggttgtgagggaatt
gtgaagcgattgcttgctactggacaggttgatgttaacataagagatcgaagatatggt
agggagccgctttcctgggctgctggggaaggccacgaggcagtggttaagctgcttctt
tctacccgggaggtggatgttgatgtaagggatccgagatatggcaggtcaccgctttcg
tgggctgctggggaaggccacgaggaagtggttgaacttctgcttgctacgggaaaggta
gatgttgaatcgaaaagcataaggggtcgtactcccctttcttgggcggcgtgggagggt
catgacatagtggtaaaactcctgctcgctactggtgaggtggttgtcaacagcagagat
tcggagggtcgtacgccgctgtcttgggcagcggagaatggcaacgaggctgtgataaag
ctcctcattgctacgggaaatgcagatgttagcgccagggatgtaaatgggcgcacacct
caggattgggcggcagagtatgatcaccagagtgtggtgaaaatttttcggatgtgctag

DBGET integrated database retrieval system