KEGG   Aspergillus niger: ANI_1_1974104
Entry
ANI_1_1974104     CDS       T01030                                 

Gene name
An12g06340
Definition
(RefSeq) hypothetical protein
Organism
ang  Aspergillus niger
SSDB
Motif
Pfam: Ank_2 Ank_4 Ank Ank_3 Ank_5 NACHT AAA_22 AAA_16 Zeta_toxin AAA_19 DUF2075
Other DBs
NCBI-GeneID: 4985985
NCBI-ProteinID: XP_001395694
AA seq 784 aa
MELDIIVQRGREVLLEIEHKLSKYNVLAFATSDWKTKAVRAWSRVKWDPAEVDSMRSRIT
YCLSLWNLVMGKINQDLTLEIGAGIQSMKGHHDMQQRNETLAWICPVDVSEQKHRILSSR
REGTGEWFLESEEFRCWISDEKSKVLLCTGAPGAGKTMLSSIAVDHFQQELAHNSSVAVA
YHYFNYQERLEFTELLSSLLRQLLQGNQRLYETITKRRYLLPPRSTRLTKENIKKVFDVV
LSECSEVLLVVDALDECNDVYVRRQFLAWTRNLLDLGGRTKVKLLATARPGDYFGTLSSR
GITLEVQANRDDMESFLDGNLDYLPGFLRRKPELWGYIRNQILESADGIFLLVRLYYNLI
LDEKNERRVRALGSKFQSGSGAYDHAYEETLKRISLQSSFSQDLAKRVLGWITFSARPLS
ALELQHAIAVEIGEPDFDKMNVTDIEEIVSACCGLITVDKSSNTAKLVHLTAQEYLKRTW
KAWYPTVHEYLTDTCLTYVSFDAFDPKTLLESGCQEHRQEYPFYQYAATELGNHLRQSLG
SNTLLASFIKNDVKVSRCMREMFGLSDTAYGLSGIHLASLFGLDQCMEELVGPESNFVNT
RDYLGRTPLTWAAGFGNSAVVEFLLDHGAIVDSATAENFTPLFYAAAYGHHEVARLLIGR
GANVHYETENKETPIFFAAKSGAGIRVGPISLVNMGDHAQVMKVLRDASADINRENKRWE
TPLFIAAANGNLRAVELLLEWGARISSTDKWKHHVADPLTAAAQRGHVEITRLLLVNGAG
SPRC
NT seq 2355 nt   +upstreamnt  +downstreamnt
atggaattggatataatcgtccagcgaggccgcgaagtcctgttggagattgaacacaag
ttgagcaaatacaatgtccttgcctttgcaacttcggactggaagacaaaggccgtccga
gcatggagtcgagtgaaatgggaccctgcagaggtggacagcatgcggagtcgcatcact
tattgtctctcgctgtggaatttagtcatgggtaaaatcaatcaagatctcaccttggag
attggggcaggcattcagtccatgaagggccaccacgacatgcagcagcgcaatgagacg
cttgcttggatttgtcctgttgacgtctcggaacaaaagcacagaattctgagctctcgg
cgcgaaggcacgggtgaatggttccttgaaagtgaagaattccgttgttggatctctgat
gaaaagagcaaggttcttctctgcaccggggctcctggcgctggcaaaacgatgctttct
tcgatcgcagtcgaccatttccagcaagagcttgcccacaatagcagcgtcgcggttgct
tatcattatttcaattaccaggaacgtctcgaattcaccgagcttctgtcaagcctccta
agacagttacttcagggaaatcaacgcttgtatgagactatcaccaaaagacgctacctt
ctcccacccaggtctacccgtttgaccaaagaaaatatcaaaaaggttttcgatgtggtg
ttgtctgaatgcagtgaagtgctgttggttgttgatgcactggatgagtgcaacgacgta
tatgtgaggcgtcaatttcttgcctggactagaaacctccttgaccttggtggtcgtacg
aaggttaaactcctcgcgactgcccgacccggcgattattttggaactctatcgtctagg
ggtattactttggaggtccaagccaacagagacgacatggaaagcttcctcgacgggaac
ctcgactatctcccgggttttcttcgaaggaaacctgagctctggggctatattcgaaac
caaattcttgaatccgctgatggaatattcctgctcgtgcgtctctattacaacttaatc
ctggatgagaagaatgaaaggagagtccgagcacttggaagtaagtttcagtcgggctcg
ggggcttacgaccatgcatacgaggagacattgaaaaggattagcctgcaaagctccttc
tctcaagaccttgccaaaagagtgcttgggtggatcaccttctctgcacggccacttagc
gctctagagctacaacatgctattgcggttgagattggtgagcccgattttgacaaaatg
aatgtcacggacatcgaagagatagtttctgcctgctgcggcttgatcacggttgacaaa
agcagcaacacggctaagctggtgcatcttactgcccaggagtacttgaagcggacgtgg
aaggcttggtatccaacagttcatgaatacctcactgacacttgcctcacgtacgtgtcc
ttcgacgcctttgatccgaaaaccttgttagaaagtggttgtcaagagcatcgacaggag
tacccgttttatcagtatgccgctactgagctagggaaccatctccgccagagcctgggc
agcaacacgcttctcgcttcattcatcaagaatgatgtcaaggtttcacggtgtatgcga
gaaatgttcggcctgtcagatactgcatacggactttcagggatccaccttgcgtcgctt
tttggcctagatcagtgcatggaagaacttgttggccctgagagcaactttgtaaatact
cgggactaccttggtcgcacacccctcacctgggctgcagggtttggtaatagcgcagtg
gtcgagttcctactcgaccatggagccattgtcgactctgctacagccgagaactttacg
cctctcttctacgccgcagcatatggtcaccatgaagtggccaggctgctaattggcaga
ggtgcgaacgttcattatgagactgaaaacaaagaaactcctatattctttgccgcgaag
agcggcgctggaattcgagtcggtcctatatccctcgtcaacatgggcgatcatgcacag
gtgatgaaagttctacgagatgcaagcgccgatatcaatcgagagaataagcgatgggaa
acccccttgtttatagctgcggcaaatggcaacctgcgtgctgttgaactgttactcgag
tggggtgccaggataagcagcaccgataaatggaaacaccatgtagcagaccccctgact
gctgccgcgcaaagggggcacgtcgagataaccaggcttctccttgtaaacggtgcaggc
tctcccagatgctga

DBGET integrated database retrieval system