KEGG   Aspergillus niger: ANI_1_1090104
Entry
ANI_1_1090104     CDS       T01030                                 

Gene name
An12g09270
Definition
(RefSeq) MFS lactose permease
Organism
ang  Aspergillus niger
SSDB
Motif
Pfam: Sugar_tr MFS_1 Glycos_transf_4 DUF3792 TRI12
Other DBs
NCBI-GeneID: 4986279
NCBI-ProteinID: XP_001395979
UniProt: A2R0P0
AA seq 535 aa
MAEKTATSVSHVDETDHPNVEIKGGVGDTALAVATSLQKPSLWSKSMLKLYGCIAVAMLN
SCINGYDGSLMGSINSYAQYRDYFGFDPNNGTPSTGIVYAIYTIGNIVGSFVAGPATDFK
GRRVGMALGSLFIIIGTIVQATCHNIGGFMGGRFILGFGVAISATAGPAYVSEMAHPAYR
GAMTGLYNVLWFGGGIPGTFIPWRTSQIEGTMSWRIPIWLQMVFSGLVLIFVPFVAESPR
WLISQDKHDAALQVLADYHGDGDRNAPIVQLEYREMIEDISQTGSDKRWWDYRELSNTRE
VRYRSMLVIIMALFGQWTGNGPVSYYYPQMLRGAGITDNNTQLMLQGVQNVVSFLGAVSG
ALITDKMGRRTQLLVSTSIVVVLFAIVTALNATNVVDGPDGTPIAKSAVAARAQIAMIYL
FGFVYSAGWTPNQAMYPVECLRYESRAKGMGMNNFFVNIASFYNTFVTGIAFTQAGWKYY
FLFIFWDTMEVIVIYFLFVETSKRTLEELTAIFQQKNPVKASLKKQDLTEIEEMK
NT seq 1608 nt   +upstreamnt  +downstreamnt
atggctgagaaaaccgccaccagcgtgtctcacgtcgacgaaaccgaccaccctaatgtc
gaaatcaagggaggggtcggcgacacggctctcgctgtggcgacgagtctccagaagccg
tctctatggagcaagagcatgctcaagttgtatggctgcatcgccgtagccatgctcaac
tcctgcatcaacggctacgatggatccctgatgggttccatcaacagctacgcccaatat
cgggactacttcggcttcgacccgaacaacggcacgccgtccacgggtatcgtctatgcc
atctacaccatcggaaacattgtcggatcgttcgtagctggtccagctactgatttcaaa
ggccgccgcgtcggcatggccctcggctccctcttcatcatcatcggcaccatcgtacaa
gcaacctgccacaacattggcggattcatgggcggacgattcatcctcggtttcggcgtc
gccatttccgctacagccggtccggcttacgtctcggagatggcgcacccggcgtaccgt
ggtgccatgacgggtctatataatgtgctgtggttcggaggcggtatcccagggacattt
atcccgtggcgcacgagtcagatcgaggggacgatgagttggcggatcccgatctggttg
cagatggtgttttcggggttggtgttaatatttgtgccttttgttgcggagagtccccgc
tggctcatctcacaagacaagcacgacgccgcgctgcaagtcctggccgactaccacggt
gacggggacaggaacgcccccatcgtgcaactcgagtaccgcgagatgatcgaggatatc
tcccagactgggtctgataagcggtggtgggattatcgcgagttgtccaatactcgggaa
gtgcggtatcggtctatgttggttattatcatggcattgttcggccaatggaccggcaac
ggccccgtcagctactactacccgcaaatgctacgcggagcgggcatcacagacaacaac
acgcagttgatgctgcagggtgtgcagaacgttgtgtcgttcctcggagccgtatcggga
gcactcatcaccgacaaaatgggccgacgcacgcagcttctcgtgtcgaccagtatcgtg
gtggttttattcgcgatcgtgacagccttgaacgctacgaacgtggttgacgggcctgat
ggcacgcctattgccaagagcgcagttgcggcgcgggcacagatcgccatgatttatctc
ttcggatttgtgtattcggctggctggacgccgaatcaggcgatgtatcccgtggagtgt
ctgcggtatgagagtcgggcgaagggcatggggatgaataatttcttcgtcaacatcgcc
tcgttctataacacctttgtgactggtattgcgttcactcaggccggatggaaatattac
ttcctgtttatcttctgggatacgatggaggtgattgtgatctacttcctgtttgtggag
acgagtaagcgcacgctggaggagttgactgctatcttccagcagaagaatccggtcaag
gcgtcgttgaagaagcaggatcttacggagatcgaggagatgaagtaa

DBGET integrated database retrieval system