KEGG   Aspergillus niger: ANI_1_106134
Entry
ANI_1_106134      CDS       T01030                                 

Gene name
An15g00560
Definition
(RefSeq) actin
  KO
K10355  actin, other eukaryote
Organism
ang  Aspergillus niger
Brite
KEGG Orthology (KO) [BR:ang00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ang04812]
    ANI_1_106134 (An15g00560)
Cytoskeleton proteins [BR:ang04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actins
    Actins
     ANI_1_106134 (An15g00560)
SSDB
Motif
Pfam: Actin
Other DBs
NCBI-GeneID: 4987655
NCBI-ProteinID: XP_001396595
UniProt: A2R4I7
AA seq 375 aa
MEEEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHHGIMIGMGQKDSYVGDEAQS
KRGILTLRYPIEHGVVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPINPKSNREKMT
QIVFETFNAPAFYVSIQAVLSLYASGRTTGIVLDSGDGVTHVVPIYEGFALPHAISRVDM
AGRDLTDYLMKILAERGYTFSTTAEREIVRDIKEKLCYVALDFEQEIQTASQSSSLEKSY
ELPDGQVITIGNERFRAPEALFAPSVLGLESGGIHETTFNSIMKCDVDVRKDLYGNIVMS
GGTTMYPGISDRMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLSTFQQMWISKQ
EYDESGPSIVHRKCF
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggaagaggaagttgctgctctcgtcattgacaatggttcgggtatgtgcaaggccggt
ttcgccggtgacgatgctccccgtgccgtcttcccctccattgtcggtcgtccccgtcac
catggtatcatgattggtatgggtcagaaggactcctacgtcggtgatgaggcacagtcc
aagcgtggtatcctcaccctcagataccccattgagcacggtgtcgtcacgaactgggat
gacatggagaagatctggcaccacaccttctacaatgaactccgtgtcgctcctgaggag
caccccgtcctcttgaccgaagcccccatcaaccccaagtccaaccgtgagaagatgacc
cagatcgtcttcgagaccttcaacgcccccgccttctacgtctccatccaggccgtcctg
tccctgtacgcctccggtcgtaccaccggtatcgttctggactctggtgacggtgtcacc
cacgttgtccccatctacgagggtttcgcccttccccacgccatctcccgtgtcgacatg
gctggtcgtgacctgacggattacctcatgaagatcctggccgagcgtggttacactttc
tccactaccgctgagcgtgaaattgtccgtgacatcaaggagaagctctgctacgtcgct
ctcgacttcgagcaggagatccagaccgcttcccagagctccagcctcgagaagtcctac
gagcttcccgacggtcaggtcatcaccatcggcaacgagcgtttccgtgctcctgaggct
ctgttcgctcctagcgtcctgggtctggagagcggtggtatccacgagaccaccttcaac
tccatcatgaagtgtgatgttgatgtccgtaaggatctgtacggcaacattgtcatgtct
ggtggtactaccatgtaccccggtatctccgaccgtatgcagaaggagatcactgctctt
gctccttcttccatgaaggtcaagatcattgctcctcccgagcgcaagtactccgtctgg
atcggtggttccatcctggcctccctgtccaccttccagcagatgtggatctccaagcag
gagtacgacgagagcggtccctcgatcgtccaccgcaagtgcttctaa

DBGET integrated database retrieval system