KEGG   Aspergillus niger: ANI_1_266134
Entry
ANI_1_266134      CDS       T01030                                 

Gene name
An15g01550
Definition
(RefSeq) hypothetical protein
Organism
ang  Aspergillus niger
SSDB
Motif
Pfam: GAS2
Other DBs
NCBI-GeneID: 4987756
NCBI-ProteinID: XP_001396695
AA seq 649 aa
MNNVHQESHGGNTPKKPLESPIKLSRSRPGRLSFEKEKNKSRGRRTSTDSSCSDYPSLVS
SPEIHEPRTSSSNGTPLLLETPPPFQDGYQSSDPVPPGSDHTLREDRLLRLDNQKSSPRA
NFAHNRNLSLPLQRFINERLEMNYDDESGSDMDGVASNRKSTDVYADLRLGQKKALLPAH
ISKFAIPSNSAQRAATQPLDAPSQGSPRPVTNGNTAKVLSKAWEHKKGSVPKNTNRSGLQ
SEPPVHSSTNRLRRQLTSHPSLESIGAYRSNTRSGDDTSSVTAISRAGSRPSTPGSQLRK
PKDHLDEKISSILSTLPARIHLMSADGQDFDAGSAATSIPLKARERFRSISPQGTPSRSS
TPTPSLTLTAAPSRRRYSHAHAPEESSVKLYHLHRGGKVAPTKLFVRSVGENGERVMVRV
GGGWADLAEYLREYAIHHGRRHVSDTPRVEVQGLSTRTSPTYSVSGRRTPSRPRSVIGNR
PSSSLAVRKTRRTSNVSDVTEFRAAQAAGDSLTASYSPMSTVSSRRRLSASSNASMGAAS
SASEFRHGSYSPSTTAAGSNSHSIPLGLAGPKPRSRNVSISPESEAWVEDVLGQARRSSS
LRPYNYGLSSQDPEPASAKAPTIPKSRSISDLGMAGSSRRVALRGLAKR
NT seq 1950 nt   +upstreamnt  +downstreamnt
atgaacaacgtgcaccaagagtcccatggtggcaatacacccaaaaagcctctggagagt
ccgatcaaactatcgaggtctcgaccagggcgcttatcttttgaaaaggagaaaaacaaa
tctcgaggccggcgcacgtctactgattcgtcttgttctgattatccatcactcgtctcc
agccctgagattcacgagccccgtacatcctcttccaatggaacgcctctgctgcttgag
actcctccaccatttcaggatggctatcagtcatccgatccagtaccacctgggagcgac
cacacgttgcgagaagatcgtttactccgcctggataaccaaaaatcatccccacgtgcc
aatttcgcccataatcgaaacctcagtcttcccttgcagcgtttcatcaacgaaaggttg
gagatgaattacgatgacgaaagcggtagtgatatggatggcgtcgcttccaacaggaag
tccacggatgtgtatgcggatttgcggctgggccagaaaaaggcactgttgcctgcacac
atcagcaagttcgccattccctccaacagcgcacagcgcgctgcaacccagcctttggat
gcaccaagtcaaggaagccctagaccggtcaccaatggcaacaccgctaaagttctgtcc
aaggcctgggagcacaagaagggctctgttccgaaaaatacaaaccgaagtggtctgcag
tcggagccgcctgtacactcaagcaccaaccgcttgaggagacagttaacttcgcatcct
agtcttgagagtatcggggcgtatagatccaacacccgatctggcgatgacacgtcttcg
gttacagctatttccagggctggatctcgaccatccaccccaggctcacagctgaggaaa
cccaaagatcacctggacgagaaaatcagttctatcttgtcaacccttcctgctcgaatc
catctgatgtctgctgatggccaagactttgatgcgggttctgcggcgacgtcaatcccc
ttgaaggctagggaacggtttcgttccatatcgccccagggaacaccgtcccgtagcagc
acacctaccccctccttgaccctgacagctgcgccctcgcgcaggagatattcgcatgca
cacgccccagaggagagctccgtgaagctctaccacctccatcgaggtggaaaggttgcc
ccgaccaaactttttgttcggtcagtgggtgagaatggagaacgcgttatggttcgagtt
ggcggtggatgggcagacctggctgaatatttgagggagtatgccatccaccatggacgc
cggcatgtttcagatacccctcgtgttgaagtccagggcctgtccacgcgtacctctccc
acgtactccgttagtgggcgtcgcactccctcccggccgcggtctgtcatcggcaatcgg
ccatcttcatcattggctgtgcgcaaaaccagacgcacctcgaacgtgtcggatgtaacc
gagttccgggcggcgcaggcagctggcgactcgctcactgcctcgtactcgcctatgtcg
actgtgtcatcccgcagaagactgtcagcttcatccaatgcctcaatgggcgctgcctct
tcagccagcgagttccgtcacggatcgtattctccttccaccactgctgcaggtagcaac
tctcattcgattccactcggccttgcagggccgaagccgcggtcgagaaatgtctcgatc
agcccagagagtgaggcgtgggttgaagatgttcttggccaagctcggaggagctcgtcc
ttaaggccttacaactatggcctgtcatctcaggacccggagcctgcttcagccaaggct
ccaaccatccccaagtcgagaagtatcagcgacctgggaatggccggttctagcagacgc
gtcgcactacgcggacttgcaaaacgataa

DBGET integrated database retrieval system