KEGG   Aspergillus niger: ANI_1_1690144
Entry
ANI_1_1690144     CDS       T01030                                 

Gene name
An16g04000
Definition
(RefSeq) hypothetical protein
Organism
ang  Aspergillus niger
SSDB
Other DBs
NCBI-GeneID: 4988793
NCBI-ProteinID: XP_001397711
AA seq 1084 aa
MNFPGEAFLFGGEETHPKLSLPSNSCLPQSLVIARHAPQNVRPTVTSRFGFPPPAGLLRY
LRRVMKRCLSPARLPCLDRGSSFVLHPSILRRLAPRHIALTSRGPFPDRRRQWSRQFSVG
AGPPINRQLLQDYVRVGMKRCPVAGPDQSNPEAWIARLDQYLPPSLRRDSDGHTNNDDVP
DDAAIRTDAAYFAQTIELANLLLHARDSGKIDLLAYVGFRLNNWPAVQFLINRLLDAADS
LKEVTLPSRPLSSYDWGLGLGLSLDELTDRSEPQAPKIPQASNGLTASDMTSLDAFTERP
YADDHSKRFMAEVWQSLGSIVLDAADASPNEAKLAMSHVFQVLARLHHSDAISDRVYKYV
PPDSYQATFRPPGMHLLSSHIMSVLSDAAWLVHEAEVAAKAAAAGEDSPYLPFKMGVREL
GPEVWLEFILWCCVEHGHIEEGVWLIDRMTSKTGDQAWKFQSWKPLLDDSGSVWQTKVDQ
EETWRQPGHQERSTMLRKRHSPTPFHGLGKRTMSTEVAAALLDSLPNQVYLGLGFRGMSP
SALLRYASSLKFAIAPSTDDGKLLPTRRTSNWFAVRVMESGGLKPEADPRTFEDFLRITP
CVVPPWDTDLYHVNEDALTRMSRSQLYDDTAALVGLIEYNIRFYSSERFCGDALNAFSWL
QAIVDSSKMQRIDEFFSSRVDRPGVVLPTPELDDLDSTEPFESSMPQLSSVTLAELIDLV
TVSRAFTFGNWLFYSDDIDGPPVSPRAYGDQALAPSIIRYATATRNAALCDAVVQSLSQP
LSSNTLRALLNSRIALHQWDAVTKLFEYLRDYRAKSWGQSNATALAAEIIRLEHTIYRQQ
PPPDPSTLQETTTSLTRAKELLSRLLKGTYNEPNHIATSRFQERAISGLYNIFLSIPGTL
HDLAASITNSSNSNKFSTPRNAIPYIPATAFHTLLSAIVDTRGSAAGQRFYDKWCLDTKS
PTSRRLQEGGIVRFYLGKERNLAKGDPHFDARYFKRAREKATMPNPTTVRIIAQAAVAEF
HEHEAEGKGAVNPAEDVLSFCIKRFEAFGMRRREINREVGGILYRRRREGDKLRREMKKE
KVRG
NT seq 3255 nt   +upstreamnt  +downstreamnt
atgaatttccccggcgaagcttttcttttcggcggcgaagaaacacatccaaagctttcg
cttccctccaacagctgcctcccccagtcgctggttatcgccagacatgcgccacagaac
gtccgtccgacggtcacatcgagatttggatttcctccgcccgcaggtctcctccgctac
ctccgtcgtgtcatgaaaaggtgcctgagtccagctcgtctgccgtgcctggaccgcggg
tcttccttcgtcctccacccttcgatcctccgtcgtctcgccccccgtcacatcgcgctc
accagccgggggcctttccccgataggcgacgacaatggagtcgccagttctccgttggg
gccggtcctccgatcaatcgccaattgctgcaagactatgttagggtgggaatgaagaga
tgtcctgttgcaggaccagatcagagtaacccggaggcttggattgcgcggctggaccag
tacctgccgccttcgttgcggagagacagcgacggtcatacaaacaatgacgatgttccg
gatgatgcagcaattcggaccgatgcggcttattttgcgcagacgattgaattggctaat
ttactgctgcatgcgcgggattctgggaagattgatttgcttgcgtatgttggtttccgg
ttgaataattggcccgctgtgcagttcttgataaatcgcctgcttgatgcggcggactct
cttaaggaggtcacgcttccttcccggcctttgtctagctatgactggggtctggggctg
gggctctcgctggatgagcttacggataggtctgagccgcaggctccgaaaatcccgcag
gcttcgaacgggctgacggcgtcggatatgacgagcttggatgcttttacagagcggccg
tatgctgatgaccattcgaaacgatttatggctgaggtgtggcagagtttggggtctatt
gtgctggatgcggctgatgcctcgcctaacgaggcgaagctggctatgtctcatgtgttc
caggttctagctcgactgcaccactctgatgccatctccgatagggtatacaagtatgtc
ccgccggacagctaccaagctacattccgacctccgggtatgcatctgctttcttctcat
attatgagtgtcctgtccgacgccgcgtggctggttcatgaagcggaggttgctgctaaa
gcggctgctgccggcgaggattcgccttatcttccattcaaaatgggagttcgtgagctt
gggcccgaggtttggctggagtttatcctctggtgctgtgtggaacatggccacatcgag
gagggagtatggctcattgatcgaatgacaagcaagacaggagaccaggcctggaaattc
cagagctggaagcccctactcgatgactccgggtcggtctggcagaccaaagtcgatcag
gaagagacttggcgacaacccggccaccaggaacgctctacgatgctgcgaaagcggcat
agcccgacgcccttccacggactgggaaagcgaaccatgagcactgaagtggccgcggcc
ttgctggatagccttcccaaccaggtatatctaggtctcggtttcagaggtatgtcgccg
agcgccctcttacgctatgcatccagtctcaagttcgcaattgccccgtcaacggacgac
gggaaattattgcctacgcgcagaacgtcgaactggttcgctgtgcgagttatggaatcg
ggaggcctcaagccggaagccgacccccggacattcgaagacttcctcaggatcacgccg
tgcgtcgttccgccctgggacaccgacctttaccacgtcaatgaagatgctttgacccga
atgagtcggtcacagctgtacgacgacactgccgccttggtcggcctgatcgagtacaac
atccggttttactcgtcggagcgcttctgcggtgacgctctgaacgcattctcctggctg
caagccatcgttgacagcagcaagatgcagcgcatcgacgagttcttctcttcgcgcgtc
gaccgacctggcgtcgttctccctacccctgaacttgatgatctggactccacggaaccc
ttcgaatcatccatgccgcaattgtccagcgtcaccttggccgagctcattgatctagtc
accgtatcgcgcgcattcacattcggcaactggctcttctactccgacgatatcgacggc
cccccagtctcgccccgcgcctacggcgaccaagccctagcaccatccatcatccgctac
gccacagccaccaggaacgccgccctctgcgacgccgtcgtccagtccctctcccaaccc
ctctcctccaacaccctccgcgcactcctcaactcccgcatcgccctgcaccaatgggac
gcggtcaccaaactcttcgaatacctccgcgactaccgcgccaaatcctggggccagagc
aacgccaccgccctcgccgcggagatcatccgtctcgagcacaccatctaccggcaacaa
ccacctccagacccctcaaccctacaagaaaccaccacctccctcacccgcgccaaggag
ctcctctcccgcctcctcaagggcacctacaacgaacccaaccacatcgccacctcccgc
ttccaagaacgcgccatctccggcctctacaacatcttcctctctatcccaggcaccctc
cacgacctcgctgcctccatcaccaactcctctaacagcaacaaattctccaccccccgc
aacgccatcccctatatcccggcaacagccttccacaccctcctctccgccatcgtcgac
acccgcggcagtgccgccggccaacgcttctacgacaaatggtgtctcgacacgaagtcc
ccgacatcacgccgtctccaagaaggtggcatcgtccgattctatctcggcaaggaacgg
aacctcgcgaagggcgatccgcacttcgatgccagatacttcaagcgcgcgagggagaaa
gccacgatgccgaatcccacgactgtgaggattattgcgcaggctgctgtagcggagttt
catgaacatgaagctgagggtaagggagctgtgaacccggctgaagatgtgttgagtttc
tgtatcaagaggtttgaggcctttgggatgcggagacgcgagatcaatcgcgaggttgga
gggatactgtataggagacggagggagggggacaagttgaggagggagatgaagaaggag
aaggtgagggggtag

DBGET integrated database retrieval system