KEGG   Aspergillus niger: ANI_1_760144
Entry
ANI_1_760144      CDS       T01030                                 

Gene name
An16g05450
Definition
(RefSeq) hypothetical protein
Organism
ang  Aspergillus niger
SSDB
Motif
Pfam: Rhodanese
Other DBs
NCBI-GeneID: 4988937
NCBI-ProteinID: XP_001397853
UniProt: A2R811
AA seq 141 aa
MSSITIATLPRISRDALSALLLSTSTPSKLAIIDVRDSDHVGGHITTSTWVPSSSLDYRL
PELIRTLADKEKVVFHCALSQQRGPSAALRYARERERVLGEEESKKQEVYVLEGGFVQWQ
EKYGPDERLTEAYVEDIWREY
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtcctccataaccatcgcaaccctcccccgcatcagccgcgatgccctctcagccctc
ctcctctccacctccacgcctagcaaacttgctatcatcgatgtccgtgactctgaccac
gtcggcggccacatcaccacctccacctgggtccccagctcctcattagactaccgactc
cccgaactcatccgcaccctagcggacaaagagaaagttgttttccactgcgcgttgagc
cagcagcgcgggccgtctgccgcgctgcggtatgccagggagcgcgagcgtgtcctcggc
gaggaggagagtaagaagcaggaggtgtatgtgcttgagggtggcttcgtgcagtggcag
gagaagtatggccctgatgagaggttgacggaggcttatgtagaggatatttggagggag
tattag

DBGET integrated database retrieval system