KEGG   Aspergillus niger: ANI_1_1018144
Entry
ANI_1_1018144     CDS       T01030                                 

Gene name
An16g07620
Definition
(RefSeq) endoplasmic oxidoreductin-1
  KO
K10976  ERO1-like protein beta [EC:1.8.4.-]
Organism
ang  Aspergillus niger
Pathway
ang04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    ANI_1_1018144 (An16g07620)
Enzymes [BR:ang01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.-  
     ANI_1_1018144 (An16g07620)
SSDB
Motif
Pfam: ERO1
Other DBs
NCBI-GeneID: 4989153
NCBI-ProteinID: XP_001398061
UniProt: A2R8L9
AA seq 600 aa
MRSAAKFFYLAVFALSRLSNAETGLHHNQDKCAIDPTAMVSDACVSYATIDHLNDQVYTL
LQSITQDTDFFSYYRLNLFNKVCPFWSDANSMCGNIACSVNTIESEDDIPLTWRAEELSK
LEGPKAGHPGRNQRKERPLNRPLQGMLGENVGESCVVEYDDECDERDYCVPEDEGASGKG
DYVSLVDNPERFTGYAGMGAHQVWDAIYRENCFLKPVPELSPVTPQLGGLQAVNDFRHVL
QQELKRPDLLPLDNECLEKRVFHRLISGMHASISTHLCWDYLNQTTGQWHPNLQCFKDRL
HDHPERISNLYFNYALVSRAVAKLQKHLHNYNYCVGDPVQDAMTREKVSKLTSTLADRPQ
IFDENVMFQDPSSAGLKEDFRNRFRNVSRLMDCVGCDKCRLWGKLQVNGYGTALKVLFEY
DETKNGENPLLRRTELVALINTLGRISHSIAAVRSFHRAMDVGDGEVFTIPASIASKERG
GKKKTRRLLKDGGSTFYYEDGDDDNFVYITEKLPWEKVRVRRDTDTVWDDIKAEFSMIWD
IYVYVLKSWVNAPKTFFEIAVLEVARVWNYWLGLPVPPRSWRIQLPKRPTPPTPPTHEEL
NT seq 1803 nt   +upstreamnt  +downstreamnt
atgcgctccgcagccaaatttttctatttggcggtatttgccctgtcgaggctttccaat
gccgagactgggctgcaccataaccaggacaagtgtgcgattgaccccactgccatggtg
tccgacgcttgtgtctcctacgccactatcgatcatctgaacgatcaagtctacaccctc
ctccaatccattacgcaagataccgatttcttctcgtactaccgtcttaatctcttcaac
aaagtctgtccattctggtccgatgcgaatagtatgtgcgggaacattgcatgctccgtc
aacacaatcgaatctgaagacgacattccgttaacatggcgcgcggaggagctcagtaaa
ctcgagggacccaaagcaggccatccgggccgcaatcaacgaaaggagcgacctcttaat
cgaccgctccaaggaatgctaggcgaaaatgttggagagagctgtgtggtggagtatgac
gatgaatgtgatgaacgggactactgtgttcccgaagatgagggtgctagcggcaaggga
gactatgtcagtctcgttgataatccagaacggttcacagggtatgccggtatgggcgcc
catcaggtttgggatgcaatctatcgggagaattgcttcctcaaaccggtgcccgagcta
tcacccgttactcctcagctgggtggtcttcaagctgtcaacgatttccgtcatgtgctt
cagcaggagttgaagcgccctgacctgcttccattggacaatgaatgccttgagaagcga
gtgttccatcgtctcatcagcggaatgcatgcgtctatctcgacccacctttgctgggac
tacctaaaccagacgacgggacaatggcatcctaaccttcaatgcttcaaagatcgtctc
cacgatcaccccgagcgcatctcgaacctgtacttcaactacgcgctggtctcgcgcgcc
gtggcgaagctgcagaaacacctacacaactacaactactgcgtcggtgatccggtccag
gatgccatgactagggagaaggtctccaagttgacctcgaccttggctgaccgccctcaa
attttcgacgagaacgtcatgttccaggatcccagctccgctggcctgaaggaagacttc
cgcaaccgattccgcaacgtcagtcgcctgatggactgcgtcgggtgcgacaaatgccgc
ctctggggcaagctccaggtcaacggatatggcaccgctctgaaagtgctgttcgagtac
gacgagactaagaacggcgagaacccgttgctgcgccggactgagctggtggcactgatc
aatacccttggtcgcatttctcacagcattgccgccgtccggagtttccaccgggccatg
gatgtgggcgatggggaggtcttcaccatccccgcgagcattgcgtccaaggagcgcggt
ggcaagaagaagacccgacgacttctcaaagacggtggctcaaccttctattatgaggat
ggcgatgatgacaactttgtctacatcaccgagaaacttccgtgggagaaggtccgggta
cgccgcgacacggatacggtctgggatgatattaaggccgagttttctatgatctgggac
atttacgtctatgtgctgaagagctgggtcaatgcaccaaagacattcttcgagatcgcc
gtcctggaggttgctcgggtatggaactactggctgggtctgcctgtgccgccacggtcc
tggaggatccagcttcccaagcgacccacccctccaacacccccgacccatgaggagctc
tag

DBGET integrated database retrieval system