KEGG   Aspergillus niger: ANI_1_1038144
Entry
ANI_1_1038144     CDS       T01030                                 

Gene name
An16g07795
Definition
(RefSeq) C2H2 finger domain protein
Organism
ang  Aspergillus niger
SSDB
Motif
Pfam: DUF2890
Other DBs
NCBI-GeneID: 4989170
NCBI-ProteinID: XP_001398078
AA seq 677 aa
MQSHADTSDFVLFPTHFTGDNKMLALDSSRQQHPPYFQSYPMDPSTFIDPLAFHVDDLGF
SQTHDQSGVPQSSNYGTPPIYSESFSDANKAAGFPPMPATPPSLPYSSDHFIPGLSTASG
PSVASASSSAIGSPNTGSAHAISEDWVQTTNGLGLPAAVMSDYFPNEYFGNTLDSEGFYQ
QKCPENFVDPSVIQPMLQQHPINPPTISFPEQPDYVVSQSAFLPQSPDPSHLHPSESYAA
NQSFAQHPSLVPTSSPSMAPALPQSRRASSYDRRSSVSSVQSQRSHPSPAASNAESDDDT
KEKGRCPFPECRRVFKDLKAHILTHQSERPEKCPIVTCEYHIKGFARKYDKNRHTLTHYK
GTMVCGFCPGSGSPAEKSFNRADVFKRHLTSVHGVEQTPPNCRKRSPTAAASKGTSSYSP
DATGKCSTCSITFSNAQDFYEHLDDCVLRVVQQEEPSEAINQKLLSEVDADEEVQKTMEK
HNLNDTAGTVDIYNDEYDDDDDDAYEYSNLRSGKGPLKSTKGSGAVARPILGVNNAVTKG
SSNANAKMRATTSKRRNNRDRYPQSWGCPSSSIKTKKRVLCVFDGQRRLWKDEMMLDNEF
EVRVKLPGGAGDGTNREAYVTDLDVETLKRAEGVLSANDEERGPWVDNQSTQLIGQPAVL
LPDTYRPHDAEPMDMTY
NT seq 2034 nt   +upstreamnt  +downstreamnt
atgcaatctcacgcagacacttccgacttcgtactattccctacccacttcaccggtgac
aacaaaatgctggccctggattcgtccagacagcagcatcccccgtacttccagtcctac
cccatggatcctagtacctttatcgatcctcttgccttccatgtggacgatctaggtttc
agccagacccacgaccaatccggtgtaccccagtcctccaactacggtacgccgcctatc
tactccgagtctttctcggacgccaataaagctgctggatttccacctatgcccgccact
cccccgtccctcccttattcttccgatcacttcattcctggactttctactgcgtccggt
ccttccgttgccagcgcctcctcgtccgccatcggatcgcccaatacgggttctgcgcat
gctatctcggaagactgggtccagacaacgaatggcttggggcttcccgccgcggtcatg
agtgactacttccccaatgagtattttggcaacacgctggactcggagggtttctaccag
cagaaatgcccagaaaactttgttgacccttctgttatacagccaatgctacagcagcat
cccatcaacccccctaccatctcgttccccgaacagcctgattatgtcgtatcgcaaagc
gcgtttctgccccaatcccctgacccttcccacctccatccctcggagagctacgctgcg
aaccaatcattcgcacagcaccccagtcttgtgccgacctcttccccttccatggctcct
gccctaccccagtcacgacgtgcttcctcttatgaccggaggtcatcggtctcctcggtt
cagtcccagcgctctcatccaagcccggctgccagtaatgcagagtccgacgatgacacc
aaggaaaagggacgatgccctttcccggagtgcagacgtgttttcaaggatctcaaggct
cacatcctgacacaccagtcagagagacccgaaaagtgccccatcgtcacctgcgaatac
catatcaagggtttcgcccgcaagtatgacaagaaccgtcatactcttactcactacaaa
ggaacgatggtttgcggcttctgcccggggtctgggtcgcccgccgagaagagcttcaac
agggcggacgtcttcaagcgccacttgacatcagtgcatggcgtcgaacagacaccacct
aactgccggaagagaagtccaactgcagcggcaagcaaggggacatctagctacagcccc
gatgcgactggcaagtgctcaacttgctccattacgttcagtaacgcacaggacttctac
gagcatctggacgactgtgtgcttcgggttgtgcaacaggaagagcccagcgaggccatc
aaccagaagctgctttctgaagtcgatgctgacgaggaggtgcaaaagacgatggagaaa
cataacttgaacgacacggctggcaccgtcgacatatacaacgacgaatatgatgatgac
gatgatgacgcttacgaatattcgaacctacgttcgggcaaaggccccctgaagagcacc
aagggatcaggggcggtggcccgtcctatcttgggcgtcaacaacgcagtcacaaagggt
tcgtccaatgccaatgctaagatgcgtgcgactacatccaagcgacgcaacaaccgtgat
cgttaccctcagtcctggggttgccctagcagcagcatcaaaacgaagaagcgtgtccta
tgtgtctttgatgggcagcgccgtctgtggaaggacgagatgatgcttgacaatgagttc
gaagtccgcgtcaaacttccgggtggtgcaggagatggcaccaaccgggaagcttacgtg
actgacttggacgtcgagacattgaagcgtgctgagggtgttcttagtgccaatgacgaa
gaacgcggcccttgggtcgacaaccagtccacccagctcattggacaaccggccgttctc
ctccctgatacgtaccggccgcatgatgccgagcccatggacatgacctactaa

DBGET integrated database retrieval system