KEGG   Aspergillus niger: ANI_1_1172144
Entry
ANI_1_1172144     CDS       T01030                                 

Gene name
An16g08720
Definition
(RefSeq) cystathionine gamma-lyase
  KO
K01758  cystathionine gamma-lyase [EC:4.4.1.1]
Organism
ang  Aspergillus niger
Pathway
ang00260  Glycine, serine and threonine metabolism
ang00270  Cysteine and methionine metabolism
ang00450  Selenocompound metabolism
ang01100  Metabolic pathways
ang01110  Biosynthesis of secondary metabolites
ang01230  Biosynthesis of amino acids
Module
ang_M00338  Cysteine biosynthesis, homocysteine + serine => cysteine
Brite
KEGG Orthology (KO) [BR:ang00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANI_1_1172144 (An16g08720)
   00270 Cysteine and methionine metabolism
    ANI_1_1172144 (An16g08720)
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ANI_1_1172144 (An16g08720)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ang04147]
    ANI_1_1172144 (An16g08720)
Enzymes [BR:ang01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.1  cystathionine gamma-lyase
     ANI_1_1172144 (An16g08720)
Exosome [BR:ang04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ANI_1_1172144 (An16g08720)
SSDB
Motif
Pfam: Cys_Met_Meta_PP Aminotran_1_2 Aminotran_5 DegT_DnrJ_EryC1 Beta_elim_lyase
Other DBs
NCBI-GeneID: 4989263
NCBI-ProteinID: XP_001398170
UniProt: A2R8X8
AA seq 409 aa
MVALPTQNGASTPQDRRFGTLAVHAGAPHDPTTGAVIAPISLSTTFAQTSVGNPVGLYEY
TRSSNPNRDNFEQAIAALEHAKYALAFSSGSATTAVILQSLAAGSHIVSVSDVYGGTHRY
FTKVASAHGVQVTFSPCIELDVEELIRPNETKLVWIETPSNPTLGLVDIEKIAAVAHKYG
ILVVVDNTFLSPYVQNPLDHGADIVVHSVTKYINGHSDVLMGVAAFNSDSLQERLSFLQN
AIGAVPSPFDCWLAHRGLKTLHLRAREATTNATAVAKALEASPNVIAVNYPGIDSHPNRA
IAVKQHRNGMGGGMLSFRIKGGQEAAHLFCKYTKIFTLAESLGGVESLCEVPSSMTHAGI
PKDQREAAGVFDDLVRMSCGVEDSEDLLADALQALEKAVAATQVENGSA
NT seq 1230 nt   +upstreamnt  +downstreamnt
atggttgctctccccactcagaacggagcgtcgacccctcaggatcgccgcttcggaact
ttggccgtccacgccggtgctcctcatgatcctaccaccggcgctgtcattgctcctatc
tccctctccaccacctttgcgcaaaccagcgtcggcaaccccgtcggtctctacgaatac
acccgcagctcgaaccccaaccgtgacaacttcgagcaggccattgccgctcttgaacac
gccaaatatgcccttgccttctcctctggctccgcaaccaccgccgtcatccttcagtct
ctcgccgcgggctctcacatcgtctccgtctccgatgtctatggtggaacccaccggtac
ttcaccaaggttgcctccgcccatggtgtccaggtgactttctcgccttgcatcgaactc
gacgtcgaggagctcatccgccccaacgagaccaagctggtctggatcgaaaccccctcc
aaccccaccctcggcctggtcgatatcgagaagatcgctgccgtggcccacaagtacggt
atcctggttgtcgtcgataacaccttcctgagcccctacgttcagaaccctctggaccac
ggtgccgatatcgtcgtccactccgtcactaagtacatcaacggtcactctgatgtcctg
atgggtgttgccgccttcaactccgacagcctgcaggagcgcctttctttcctccagaac
gccatcggcgccgtcccctcccccttcgactgctggctcgcccaccgtggtcttaagacc
ctccacctgcgtgcgcgcgaggccaccaccaacgccaccgccgttgccaaggccctcgag
gcttcccccaacgtcatcgccgtcaactaccccggcattgactctcaccccaaccgcgcc
attgccgtcaagcagcaccgcaacggcatgggcggtggtatgctgagcttccgtatcaag
ggcggtcaggaagccgctcacctcttctgcaagtacactaagatcttcactctggctgag
agtctgggtggtgtcgagtctctctgcgaggtgccttccagcatgacccacgccggtatc
cccaaggaccagcgcgaggctgctggtgtcttcgatgaccttgtccgtatgtcctgcggt
gttgaggattccgaggacctcttggccgacgcccttcaggctcttgagaaggctgtggct
gcgactcaggtcgagaatggatctgcttag

DBGET integrated database retrieval system