KEGG   Aspergillus niger: ANI_1_1264144
Entry
ANI_1_1264144     CDS       T01030                                 

Gene name
An16g09320
Definition
(RefSeq) alanyl-tRNA synthetase, cytoplasmic
  KO
K01872  alanyl-tRNA synthetase [EC:6.1.1.7]
Organism
ang  Aspergillus niger
Pathway
ang00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ang00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ANI_1_1264144 (An16g09320)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ang01007]
    ANI_1_1264144 (An16g09320)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ang03016]
    ANI_1_1264144 (An16g09320)
Enzymes [BR:ang01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.7  alanine---tRNA ligase
     ANI_1_1264144 (An16g09320)
Amino acid related enzymes [BR:ang01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   ANI_1_1264144 (An16g09320)
Transfer RNA biogenesis [BR:ang03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    ANI_1_1264144 (An16g09320)
 Prokaryotic type
    ANI_1_1264144 (An16g09320)
SSDB
Motif
Pfam: tRNA-synt_2c tRNA_SAD DHHA1 DUF3347
Other DBs
NCBI-GeneID: 4989323
NCBI-ProteinID: XP_001398230
AA seq 1019 aa
MLQPTSRLMRIHRFIKEGELALTHLSSPFRSQPRTFYHLHTPPLPNIPPARTITRPFSMA
SDNDPKLEWTSKRVRDTFLQYFKENGHTFVASSPVVPHSDPTLLFTNAGMNQFKSIFLGT
VDPHSDFANLKSAVNSQKCIRAGGKHNDLDDVGKDSYHHTFFEMLGNWSFGDYFKKDAIR
YSWELLTKIYGLDPRRLYVTYFEGNKEGGLEPDLEAKDLWKAVGVPEDHILPGNMKDNFW
EMGDQGPCGPCSEIHYDRIGGRNAAHLVNQDDPNVLEIWNNVFIQYNRETDRSLRPLPNK
HVDTGMGFERLVSVLQNKSSNYDTDVFTPIFQTIRDVTGAREYRGCFGSDDADGIDTAYR
VIADHVRTLMFAISDGAVPNNDGRGYVIRRVLRRGARYARKYFGVEIGNFFSKIVPTVVD
QLGDMFPELRRKQPDVMEILDEEEMSFAKTLDRGERQFEHYAQQAKAKGADKLHGADVWR
LYDTFGFPVDLTRIMAEERGLQIDDREFEEARSRAKEASRGQKKTSAETVKLDVHDLGKL
EAMNDVPKTDDTAKFGKGNITAQVKAIYHGKTFHSSTDEVPDGEQLGIILDRTNFYAEQG
GQENDTGKIVIDGQSELEVGDVQLYAGYVLHTGFMKYGSFSVGDTVICEYDELRRWPIRN
NHTGTHILNFALRTVLGDGVEQKGSLVAAEKLRFDFSHKSAISDKDLARIEEISTEYIRQ
NCTVYSQELPLATAREISGVRAVFGETYPDPVRVVSVGVELGEILQNVKDPRWKEVSIEF
CGGTHVQKTGDIKDLIVLEEGGIAKGIRRIIAVTGEDAHEVQRLAAEFQKRLDLLEAMPL
TPEKEKEAKQIQAELNQLSISAVQKSAFRERFARINKEVIDGQKALQKLESKVALETITN
YFQAPENQDRSWLVAKLPISANSKAISESLNYVKSKLPDKSVYVLAASTDQGRVAHGCYV
SKSSSEAGASASEWAAIVSGAVGGKAGGKGATSVGNGVNPDRVDEAVSLASDYLGKLKL
NT seq 3060 nt   +upstreamnt  +downstreamnt
atgttacaaccgacgagtcgcttgatgcgtattcataggttcataaaggagggggaactg
gctttgactcatctatcttcaccttttaggtcgcaacccagaacattctaccaccttcac
actcccccactcccaaatattccgcctgcaagaaccatcacaagaccattcagtatggct
tcagataatgatcctaagttggaatggacctccaaacgtgtccgtgatacgttccttcaa
tatttcaaggaaaatggccacactttcgttgcctcgtctcccgttgttccccattctgat
ccaacattgttatttacgaacgctggaatgaatcagttcaaatcaatctttctaggaacg
gtggatcctcactctgatttcgcaaacctgaaaagtgcagtcaactctcaaaagtgcatt
cgtgctggaggaaagcataatgacctcgacgacgtgggcaaggatagctatcatcatact
ttctttgaaatgctcgggaactggagttttggggactatttcaaaaaggatgcgattcgc
tattcctgggaattgttaaccaagatttacggtttagatcccagacgtctctatgttacc
tatttcgaagggaacaaggaaggtggtctagagccagatctcgaggccaaagatctgtgg
aaggccgttggcgttccggaggatcatattctcccaggcaacatgaaggacaatttctgg
gagatgggtgatcaaggcccatgtggcccttgcagcgagattcactatgaccgaatcggt
ggacgtaatgctgcccatctggtcaatcaagatgacccaaatgtattggaaatttggaac
aacgtcttcatccaatacaatcgtgaaacggatcgatccctgcggccgttgcccaacaag
catgtcgacaccggaatgggatttgagaggttggtgtctgtcttgcaaaataagtcgtca
aactacgatacagatgtgttcactcccatattccagaccattcgagatgttaccggagct
agggaataccgtggatgcttcggtagtgatgacgctgatggtattgatactgcctatcgt
gtcatagcggatcatgttcggaccttgatgtttgctatctcagacggtgcggtcccaaat
aatgatggccgcggctatgtcatccgtcgtgttctccgtaggggtgctcgatatgccaga
aaatacttcggtgtcgagattggcaatttcttctcaaagatcgtcccaacagtcgtcgat
caactgggcgatatgtttccagaactgagaaggaaacaacccgacgttatggaaatctta
gacgaagaagagatgtcatttgctaagactttggatcgcggcgagcggcaatttgagcat
tatgcccagcaggctaaggcgaagggggctgataaattgcacggcgccgatgtctggagg
ctctatgacacgttcggattcccggttgaccttactcgtataatggcagaagaacgggga
ttacagatcgatgaccgagagttcgaggaagcgcgttcgcgagcgaaagaagcaagcaga
ggccagaagaaaacttccgctgaaacagtgaagttggacgttcatgatctgggcaagctc
gaagccatgaacgacgtccccaagactgatgatactgctaagtttggaaagggtaatatt
accgcccaagtaaaggccatataccacggcaagacgttccactcatctacggacgaggtg
cccgacggcgagcaacttggaattattcttgaccggacgaacttctacgctgaacagggt
ggacaagagaatgacacgggtaaaattgttatcgatggacaatccgagcttgaagtaggt
gatgttcagctttatgctggatacgtcctgcatactggtttcatgaaatatggctccttc
tcggtaggtgatactgtcatctgcgaatatgatgaactgcgtcgttggccgatcagaaac
aaccacaccggaactcatattctcaactttgcgctcagaacagtcttaggggacggtgtg
gagcaaaaaggttcccttgtcgcagcggagaagctgagattcgacttctctcacaagtct
gctatttcggacaaggatctggctcggattgaagaaatttcgactgagtatattcgacaa
aactgcactgtttactctcaagaactccctcttgcaacagcccgggagatctctggagtt
cgtgctgtatttggagagacttatcctgacccggtccgcgttgtctccgttggtgtggag
ctgggtgagatactccagaacgtgaaggatccgcggtggaaagaggtcagcattgagttt
tgtgggggtactcatgttcagaagacaggagacatcaaggatctcattgttctagaagag
ggcggtatcgccaagggcatccgcagaattatcgctgtgaccggcgaagatgcgcatgaa
gtgcagcgtttggcagcggaattccaaaaacggctcgatcttctagaagcaatgccccta
actccagagaaagagaaggaagcaaagcagatccaggccgagctcaatcagctttcgatt
tctgctgtacagaaatccgcctttcgcgaacgtttcgcgcgtattaacaaggaggttatc
gatgggcaaaaggctctacaaaaactcgaatcaaaagtcgcgctggagaccataactaat
tacttccaagctccggaaaatcaagacaggagttggcttgtcgccaagctccccatctct
gcgaactctaaagcaattagcgaatctctaaattacgtgaagtcaaagttgcccgacaag
tcggtatacgttttggctgcaagcaccgatcaaggccgtgttgcccatggctgttacgtg
tcgaagtcatcaagcgaggccggtgcctccgccagtgagtgggcagctatcgtttctggt
gcagtcggggggaaggcgggaggtaaaggagctacctcagtcggcaacggagttaatccc
gacagagtcgacgaagctgtcagcttagcttctgactaccttggcaagttgaagttatag

DBGET integrated database retrieval system