KEGG   Aspergillus niger: ANI_1_760164
Entry
ANI_1_760164      CDS       T01030                                 

Gene name
An18g05750
Definition
(RefSeq) hypothetical protein
  KO
K09140  pre-rRNA-processing protein TSR3
Organism
ang  Aspergillus niger
Brite
KEGG Orthology (KO) [BR:ang00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:ang03009]
    ANI_1_760164 (An18g05750)
Ribosome biogenesis [BR:ang03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    ANI_1_760164 (An18g05750)
SSDB
Motif
Pfam: Ribo_biogen_C RLI Autophagy_act_C Hydrolase_3
Other DBs
NCBI-GeneID: 4990141
NCBI-ProteinID: XP_001399026
UniProt: A2RB74
AA seq 378 aa
MVRHKKDNFARGGKKFSSKGPRPPRRDPADPDADDADRPSRPPFKAACWDLGHCDPKRCS
GKRLMNFGLMRELQIGQRFPGVIVSPNAKKIISPADKDLLEQFGAAVVECSWVRVKEVPW
SRIGGKCERLLPYLIAANTVNYGKPWRLNCVEALAACFCICGHEDWARQVLKPFRYGEAF
LEINGKLLKRYAACADEDEIKRAEEEWLAKIEREYEESRAAGGADIWTVGNTNRRVESDS
DDDDEEGSGKENNDEEEEEEEDKDPFAISDDSEEEEQMAAIRAKILNSKSFQNPSASDKP
QPEKIARPEEEGSKSRPLEDSDAESGSAEGSEDEAFDSIINATPVTDRMGIIAAQKKKEK
ETFSASFSRTVVDAPKRW
NT seq 1137 nt   +upstreamnt  +downstreamnt
atggtccgccataaaaaggacaacttcgctcgaggaggcaagaaattctcctccaagggt
ccccgtcctccccgccgcgatcccgccgaccctgacgccgatgatgccgaccgcccctcc
agacctcccttcaaagccgcctgctgggatctgggtcactgtgatcccaagcgctgctca
ggaaagaggttgatgaactttggtctgatgcgcgagctgcagattggtcagcgattccca
ggtgtaattgtctctcccaacgcaaagaaaatcatctcccccgctgacaaagacctcctc
gaacaattcggcgccgcagtagtagaatgttcctgggtgcgagtgaaggaagttccctgg
tcgcggatcggaggcaaatgcgaacgactcctaccctacctcatcgccgccaacacagtc
aactacggcaaaccctggcgtctaaactgcgtcgaagcgctagccgcctgtttctgcatc
tgcggccacgaagactgggcccgccaagtcctgaaacccttccgctacggcgaagccttc
ctagaaatcaacgggaaactacttaagcggtacgccgcgtgcgccgacgaagacgaaatc
aagcgcgccgaggaggaatggctggccaagatcgagcgcgaatatgaggagagtcgggcc
gcgggcggcgcagatatctggacagtgggaaatacgaatcggagggtggagtcggattcc
gatgacgatgatgaggagggctctggcaaggagaacaacgatgaggaagaagaggaagag
gaagataaagaccccttcgcgatatcagacgactccgaagaagaagaacaaatggccgct
attcgcgccaagatcctgaattccaaatcgtttcagaacccctctgcctcggataagccg
cagccggagaagattgctcggccggaggaggaagggtccaagtcgagaccgttggaggat
tcggatgccgagtccgggtccgcggagggtagtgaggatgaggcgttcgatagtatcatc
aatgcgacgccggtgacggatcggatggggattattgcggcgcagaagaagaaggagaag
gagacatttagtgcgtcgttttcgaggacggtcgtggatgcgccgaagaggtggtaa

DBGET integrated database retrieval system