KEGG   Aspergillus niger: ANI_1_832164
Entry
ANI_1_832164      CDS       T01030                                 

Gene name
An18g06270
Definition
(RefSeq) 14-3-3 protein
  KO
K06630  14-3-3 protein epsilon
Organism
ang  Aspergillus niger
Pathway
ang04011  MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:ang00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04011 MAPK signaling pathway - yeast
    ANI_1_832164 (An18g06270)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ang03400]
    ANI_1_832164 (An18g06270)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ang04147]
    ANI_1_832164 (An18g06270)
DNA repair and recombination proteins [BR:ang03400]
 Eukaryotic type
  Check point factors
   Other check point factors
    ANI_1_832164 (An18g06270)
Exosome [BR:ang04147]
 Exosomal proteins
  Proteins found in most exosomes
   ANI_1_832164 (An18g06270)
SSDB
Motif
Pfam: 14-3-3 Orbi_VP5
Other DBs
NCBI-GeneID: 4990195
NCBI-ProteinID: XP_001399080
UniProt: A2RBC8
AA seq 272 aa
MTSERENKTFLARLCEQAERYDEMVTYMKEVANIGGELSVDERNLLSVAYKNVVGTRRAS
WRIISSIEQKEESKGSEQHVSIIRDYRQKIETELEKVCQDVLDVLDESLIPKAETGESKV
FYYKMKGDYHRYLAEFASGNKRKVAATAAHEAYKNATDVAQTDLTPTHPIRLGLALNFSV
FYYEILNSPDRACHLAKQAFDDAIAELDSLSEESYRDSTLIMQLLRDNLTLWTSSDGNEP
EGAAPKEDKPEEETAAAPEDKAEEPKPAAPES
NT seq 819 nt   +upstreamnt  +downstreamnt
atgacttctgagcgtgagaacaagacgttcctcgcccggctctgtgagcaggctgagcgc
tacgatgagatggtcacgtacatgaaggaagtcgccaacattggaggcgagctttccgtc
gatgagcgtaaccttctctccgttgcttacaagaacgtggtcggtacccgccgtgcctcg
tggcgtattatctcctccattgagcagaaggaggagtccaagggctctgagcagcacgtt
tcgatcatccgtgactaccgccagaagatcgagaccgagctcgagaaggtctgccaggat
gtcctcgatgttctcgatgagtccctcatccccaaggccgagactggcgagtccaaggtc
ttctactacaagatgaagggtgactaccaccgctacctcgctgagtttgcctctggcaac
aagcgcaaggttgctgccactgctgcccacgaggcttacaagaatgctaccgatgtcgcc
cagaccgatcttactcctacccaccccatccgccttggtctcgccctgaacttctccgtc
ttctactacgagatcctgaactcccccgatcgtgcctgccaccttgccaagcaggcgttc
gatgacgccattgcggagctcgactcgctttcggaggagagctaccgtgatagcaccctg
atcatgcagctcctgcgtgacaaccttactctgtggacctcttctgatggcaacgagccc
gagggcgctgcccccaaggaggacaagcccgaggaggagaccgccgccgcccccgaggac
aaggctgaggagcccaagcctgctgcccctgagtcctag

DBGET integrated database retrieval system