KEGG   Aspergillus niger: ANI_1_1470164
Entry
ANI_1_1470164     CDS       T01030                                 

Gene name
An18g06520
Definition
(RefSeq) proteasome component (Ecm29)
  KO
K11886  proteasome component ECM29
Organism
ang  Aspergillus niger
Brite
KEGG Orthology (KO) [BR:ang00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:ang03051]
    ANI_1_1470164 (An18g06520)
Proteasome [BR:ang03051]
 Eukaryotic proteasome
  Proteasome interacting proteins (PIPs)
   Other PIPs
    ANI_1_1470164 (An18g06520)
SSDB
Motif
Pfam: Ecm29 Vac14_Fab1_bd HEAT
Other DBs
NCBI-GeneID: 4990220
NCBI-ProteinID: XP_001399105
AA seq 1863 aa
MATDTTPASSEARELSLISKVELRIALADTDAKLETLLNTYLPPLLLKLGSESLAVRNKV
IAVCQHVNTRVQAPSIKLPVTALLKQFKEQKSQLIRHFDLIYLQQGIDRLGSDARVEILL
PLLQGISEIGTSVNQAAVVFNLVLRLLPLLKLPPKGSDDDVQLKARLGLSDQDTQFLSKW
FEKLLLLFPADKDSPTCPGLSPADYTFLNKDAPVTETWNPSAEGGLNLTETKVNALRFLA
SGAFSHTERFLPALIASADTNSRLSDIGEETLKRFVPDLEAPDVVQQLYGLYFGAATPDG
APPARPALQTRILVFLGKSIRATKDRLSVMRVIEEGLLSDAARSSQGLLASKLRTQIFNF
TTWVVKMGSPSDLEEIAPKLIAGLRDFIQSQGWPSPAASGQKLPSTDLSLRGLAYESIGI
MVPKTNFELYDGQEGLSGFGLIQWLFTSLSSDDSSSQIFVSIEQALGSILNSSIDSWDND
FQDQLRPFLIRQMNNYPGGEDPTSGFAVVRGPQYAAVRFANRFLPYHDVVARWIDLMAIA
RGSENKHEVMEEGKKGLHPFWYRLLSPSNANHSVSRTKDSMWYDFPKFSELTRFIFGSAT
SNGVSGSSASEIAAGPFKNAFASTIAFIRNVLLWESLSASKTTIEVDQDWDTKLDVMLTS
DEQARSSLKHYLRATDKEGVVLFLNSALAGLTRESREGLQQCGAHFVSICSLASNDIVEA
VVPQTLVLRIPLKSNDQDIQAMAARAIGILASHPALPDNDLMALVAECSECITSWKTAIG
EGALRVRGAVLALSYILSRLAFRNMRSRVPSVHIDQFVHTIRDMIENARDSLLRRSAQLA
IGQLSLSKILSPSMLSDAEWKVIKEVLVRDAKAESEVAIMALGLLSAIFPKENTGDSHFS
TLTEALYDLHEIRSPEIHFTVGEALSNAAAGWDSKSLNLEFDVDSGSPNSNVPEQVLASV
ADTIIAKCGAPKPSLKRASAIWLLSLVKNCGHLTLMQDRLRQCQSSFSSLLVDRDEVVQE
TGAQGLSLVYGMGDQSLKDDLVRDLVNSFTENNSTLSGGRVSQNTELFEPGALPTGGGSS
VNTYKDIMNLAAEAGDPTLVYRFMSLASNNALWSSRAAFSKMGISSIFSDSSVNGYLAKN
PKIYPKLFRYRFDPNPNVQRSMNTIWKALVKDPMEVIETHFDEIMNDLLKSLLTGREWRV
RQASCTAIADLIQGRQPEKYAQYMDEIFTKAFKLLDDIKETVRASALKLCQTITNAIIRT
LETSDTDTKRAETMLRSAIPFLLSDKGMESGVEEVQGFAIGALIQMIRKSPGRPLRPFIP
HIMEQFLNSLSSLEPQAVNYVHLNADKYGLTGQDIDKMRLSSIRTSPMMEVIERYLIDML
DEQSMKEFATRLEGVLRSAVGLPSKVGCSRVLVLLSMRSMLFRPYADRFIQILGKFVVDR
NDTVSASYCTSIGYLLRLASDNRVLKTIEHAKDLYLTAEDSNQRVISAEILQAASKLSND
RFMAFATAALPFIFVSKCDLDEHVREVFEKTWQDNVGGNRTVSLYIKEITDLVSSNLDSA
RWAIKHTAALGLAKAIMSMDSELDLPTIEYVWPVLERAVAGKTWEGKEVVLEAFVKFSGQ
AKKLWQEKPTLGETMKTITIREAKRNNPAYRPHALIALGGVAQARKDLDLMSDAIAIVTH
VLDDVEDQGDPMDVDSGKDQKPKQTLDDTLAACVVCLLQCLSLASHTSAQTIDGHLDKSR
PALRRILVGHGGRNVQVTLYRELRTVFDQFGAWVSERSGEPDRRGPQESLAALTAEIFAH
EIDLSVEAVRAERAQAAVAYFKLCKQTELPIDQNIQKLVKNWREEERSGPVRQILDRALV
HLQ
NT seq 5592 nt   +upstreamnt  +downstreamnt
atggctacagacactacgccagcaagctccgaagctcgcgagttgagcttgatatccaag
gttgagcttcggatcgcgctggcggataccgatgccaaactggaaactctgcttaataca
tatctacctcccctcctattgaagctgggatctgaaagtcttgctgttcgcaataaagta
atcgcagtttgccagcatgtcaacactagagtccaagctccctctatcaaattgccggtg
acggctttgctgaagcagttcaaagagcaaaagtcccagctcatccggcatttcgacttg
atctaccttcaacaaggtattgatcgcctgggctcagatgcaagagtcgaaattttgctg
cccttgcttcagggaatatctgagatcgggacatctgtcaaccaagctgccgtggtattc
aaccttgtcctgcggcttctgcccttgcttaagctaccaccaaagggcagcgacgatgat
gtgcagctcaaagctcgactaggtctatctgatcaagacacgcagtttctatcgaaatgg
tttgagaaattgctgctccttttccccgctgataaggactcgcccacttgtcccggattg
tctcctgcagattatacgtttttgaacaaggacgccccggtaacagaaacatggaatcct
tctgcagaaggtggcctgaacctgacagagaccaaagttaacgctttgagatttctcgct
agtggagctttcagccacacagagcggttcttgccggctcttattgcgtctgcagataca
aactctcgtctctccgatattggtgaagagacgctgaagagattcgttccagacttggag
gcgccagatgttgtacagcaactttatggcttgtactttggagccgcaacgcctgatggc
gcacctccggcgcgacctgctttgcagaccagaatcctggttttcctaggaaaatcgatt
agagcaacgaaggatagattgagtgttatgcgggtgattgaagaaggtcttctatcagat
gccgcaaggtcatcacaaggattgttggcctcgaagttgagaacacaaatattcaacttt
actacctgggttgtaaaaatgggttctccgtccgacctggaagaaatagcaccgaagcta
atagcaggcttgagagatttcatacagtctcaaggatggccgagtccagccgccagcgga
caaaagcttccaagtacagatctgagtctacggggtcttgcgtacgaaagcattggtatt
atggttcccaaaaccaattttgaactgtacgatgggcaggaaggtctctctggctttggt
ctcattcaatggctgtttacttccttgagctctgatgattccagctctcagatatttgtg
agcattgaacaagccctgggcagcatactcaactcctcaatagatagctgggacaatgac
ttccaagaccaactgcgacctttcttgattcgtcagatgaataactaccccggaggagaa
gatccaacaagcgggttcgctgtcgttcgcggcccccagtacgctgctgtacgttttgct
aacagatttctgccataccacgatgttgtcgcccgctggatagacctcatggcgattgcg
cgcgggtcagaaaacaaacacgaagtcatggaggaaggcaagaaaggtctacatccattc
tggtaccggcttctgagtccttcaaatgccaaccactcggtctcacgcacaaaagattct
atgtggtatgatttcccaaagttttcggaacttactcgcttcatatttgggtcggcaact
tcaaacggggtatcaggttcttctgcatcggaaatagcagcagggccctttaagaacgca
tttgcttccactatagcattcatccggaacgttctgctctgggagtcactttctgcttct
aagaccaccatagaggtcgatcaagactgggacactaaacttgacgtgatgcttacatct
gacgaacaagcaaggtcgtctcttaaacattatcttcgggctaccgacaaagaaggggtt
gttctgtttttgaacagcgctttggctggcctcacccgtgagagccgggagggactacag
caatgcggagcacatttcgttagtatatgctctttggcctcgaacgacatcgtggaggcg
gtggtcccgcagacactagtgttgcgaatcccgttgaagagtaacgaccaagatattcag
gccatggccgcccgcgctattggaatcctagcctctcatcctgcccttcctgataatgat
ctcatggcactggttgcggagtgctcagagtgcataacatcatggaagactgcaattggt
gagggtgcacttagggtccgaggagcggtattggcactatcatatatactgagcagactt
gcattccgtaacatgagatctagggtgcccagcgtccatatagatcaattcgttcatact
atccgtgacatgatcgaaaacgcgcgcgactcactccttcgacgttctgcacagttagca
attggacagctcagtctctccaaaattctgtctccttctatgctttctgatgcggagtgg
aaagtcatcaaggaggtcctcgtacgggacgcaaaggccgaaagcgaagtggccataatg
gcactggggctcttgtctgcaatctttccaaaggagaacactggtgattcacacttcagt
accctaacagaagccctttatgatctacatgaaatccgcagccctgagatacacttcact
gtcggtgaagcactaagcaatgctgcggctggctgggactcaaaatcattgaacctggaa
ttcgatgtagactccgggtcaccaaactcaaatgtgccggaacaagtgcttgcgagtgtg
gctgacacaatcattgccaaatgtggcgcaccgaaaccgtcgcttaaaagggcgtctgcc
atttggctattaagtctggtcaaaaactgcggtcatctaaccctgatgcaagatcgtctg
cgtcaatgccaaagctcctttagcagcttgctcgttgatcgagacgaggtggtacaggaa
actggcgcacagggattaagcctcgtttatggcatgggtgaccagagcctgaaagacgat
ttggtgcgtgacttggtaaactccttcaccgagaacaattcgaccctctcgggtggcagg
gtcagccaaaatacagagctcttcgaacctggggctctccctactggcggcggttcctct
gtcaatacctacaaagacatcatgaacctcgcagccgaagctggtgacccaaccctcgta
tatcgcttcatgtccttagcttcgaataatgccctttggtcgagtcgtgcggctttcagc
aagatgggcatcagcagtatcttttctgactcgagcgtcaatggttacctagcaaagaac
cctaagatttatcccaagctatttcgctaccgttttgaccctaatcccaatgttcaacgg
tccatgaataccatctggaaggccttggtcaaggatccaatggaagttattgagacccat
tttgatgagatcatgaatgatctgttgaaaagcctgttgacaggccgggaatggagggtt
cggcaggcaagttgtactgcaatcgcggatttaattcagggtcgtcagcccgagaaatat
gcgcagtacatggatgagatctttaccaaggcattcaagctcttggatgatattaaagag
accgtccgagcttcagcactgaagctttgccagacgattaccaatgcgattatccgcaca
ttggagacaagcgacactgataccaagcgagccgaaaccatgctacgaagcgccatcccg
ttcctattgagtgataagggcatggaatccggtgttgaggaggtccaaggattcgccatt
ggggctctgatccaaatgatccgaaaaagcccaggtagaccattgcggccgttcataccc
cacataatggaacagtttctgaattctttgagttcactggagccacaagcagtcaactac
gtccacctgaacgcggataaatatggcctgacaggccaggatatcgacaagatgaggttg
tccagcattcgaacatctcccatgatggaagtgattgagagatacctcatagacatgttg
gatgaacagagtatgaaagagtttgccacgaggcttgaaggcgtgttgcgctcggccgtt
ggacttccatccaaggttggctgtagccgagttttggtccttttgagcatgcgatccatg
ctcttccgcccctatgcagatcgtttcatacaaatcctcggcaaattcgtggtggatcgc
aatgacaccgtcagtgcatcctactgtacatctattggctatctcctacgtctcgcctcg
gataatcgagtgctgaagacaatcgagcatgccaaagatctatacttgaccgccgaagac
tctaaccagcgcgttatttcagccgagatcttgcaagccgcttcgaagttgtccaatgac
cggtttatggcattcgctacggcagcactgccattcatattcgtgtccaaatgtgacttg
gatgagcacgtcagggaggtattcgaaaagacgtggcaggataatgtcggcggcaaccgc
acggtgtctctctacatcaaggagattaccgaccttgtatcgagcaatctagattcggcc
cggtgggccattaagcatacggcagctttggggcttgcaaaggccattatgtcgatggac
tcggagctcgatctcccgacaatcgagtatgtatggcctgtgctagagagagctgtggct
gggaaaacgtgggagggcaaagaagttgtgctagaagcgtttgtgaagttctcgggccaa
gcgaagaaattgtggcaagagaagccaacacttggagaaacaatgaagaccatcactatc
agagaagcgaagcggaataaccctgcatatcgcccccacgcgcttattgctctcggcgga
gtagctcaagcacgcaaagacttggatctgatgtcagacgctattgccattgtcacccac
gtgctggatgatgttgaagatcagggagatccaatggatgtggattcaggcaaggatcaa
aagccgaaacaaaccctggacgacacgttggcggcttgtgtggtatgtctcttacaatgc
ctcagtcttgcatcgcatacatcagcacagaccatcgacggacacctggataagtcgaga
ccggcgttgcgcagaatactagtgggccatgggggcagaaacgtgcaggttacgttgtac
cgggagctgcgcacagtttttgaccaattcggggcgtgggtatcggaacggagtggcgaa
cccgatcgccgtgggccccaggagtccttggcggcactaacagcagagatcttcgcccat
gagatagacctctccgttgaagccgttcgagctgaacgcgcccaagcggctgtcgcatac
tttaagctctgcaagcagacagaacttccgatcgatcagaacatccagaaactggtgaaa
aactggcgggaagaggagagatcgggaccagtccgacagatcctcgatcgggcactcgtc
catctgcaatga

DBGET integrated database retrieval system