KEGG   Altererythrobacter namhicola: A6F65_01816Help
Entry
A6F65_01816       CDS       T04447                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
anh  Altererythrobacter namhicola
Pathway
anh00071  Fatty acid degradation
anh00072  Synthesis and degradation of ketone bodies
anh00280  Valine, leucine and isoleucine degradation
anh00310  Lysine degradation
anh00362  Benzoate degradation
anh00380  Tryptophan metabolism
anh00620  Pyruvate metabolism
anh00630  Glyoxylate and dicarboxylate metabolism
anh00640  Propanoate metabolism
anh00650  Butanoate metabolism
anh00900  Terpenoid backbone biosynthesis
anh01100  Metabolic pathways
anh01110  Biosynthesis of secondary metabolites
anh01120  Microbial metabolism in diverse environments
anh01130  Biosynthesis of antibiotics
anh01200  Carbon metabolism
anh01212  Fatty acid metabolism
anh02020  Two-component system
Brite
KEGG Orthology (KO) [BR:anh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    A6F65_01816 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    A6F65_01816 (thlA)
   00640 Propanoate metabolism
    A6F65_01816 (thlA)
   00650 Butanoate metabolism
    A6F65_01816 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    A6F65_01816 (thlA)
   00072 Synthesis and degradation of ketone bodies
    A6F65_01816 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    A6F65_01816 (thlA)
   00310 Lysine degradation
    A6F65_01816 (thlA)
   00380 Tryptophan metabolism
    A6F65_01816 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    A6F65_01816 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    A6F65_01816 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    A6F65_01816 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:anh04147]
    A6F65_01816 (thlA)
Enzymes [BR:anh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     A6F65_01816 (thlA)
Exosome [BR:anh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   A6F65_01816 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt DUF5417
Motif
Other DBs
NCBI-ProteinID: ANU08111
UniProt: A0A1C7D9W6
Position
1820374..1821570
Genome map
AA seq 398 aa AA seqDB search
MAAFSANDPIVILSYARTPMGAMQGALSDVAATDLGATAVKAAVERAGIAGGDANRIYMG
CVLPAGLGQAPARQAALKADLPKSVQATTVNKVCGSGMQTVIMAGEALASGTIDIAIAGG
MESMTNAPYLLKKHRGGARLGHDRVYDHMFLDGLEDAYEEGRAMGTFAQDMADKYSLTRE
QMDDYSIASLDRANKAIESGAFDDEIVPVTFSTRKGDVTVDTDESPSKGRPDKIPTLRPA
FAKDGTITAATSSSISDGAAAVVVARESVARDKGLTPVAKIVGMTAHAQAPEEFTIAPVG
AIEKLLEQTGWSADDVDLWEVNEAFACVTMFAMQDIGIPHEKINVNGGGTALGHPIGASG
TRILVTLLAALKARGGKRGIASLCIGGGEATAVAVELC
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggccgcattctccgcaaacgacccgatcgtgatcctctcctacgcccgcacgccaatg
ggcgcgatgcagggtgcgctttccgacgtcgcggcgacggaccttggcgcgactgccgtg
aaggccgccgtggagcgtgccgggatcgccggcggcgatgccaaccgcatctacatgggc
tgcgtccttcccgcgggcctcggccaggcgcctgcccgccaggcggcgctgaaggcggac
cttcccaagagcgtgcaggccaccacggtcaacaaggtctgcggcagcggcatgcagacg
gtcatcatggccggcgaggcactggccagcggcacgatcgatatcgccatcgctggcggc
atggagagcatgaccaatgcgccctacctgctgaagaagcaccgcggcggcgcgcgcctt
ggccatgaccgcgtgtatgaccacatgttcctggacggtctggaagatgcctatgaggaa
ggccgcgccatgggcactttcgcgcaggacatggccgacaagtacagcctgacgcgcgag
cagatggacgattactccatcgccagcctcgaccgggccaacaaggcgatcgaaagcggc
gcgttcgatgacgagatcgtccccgtaaccttctccacccgcaagggcgatgtcacggtc
gacaccgatgaaagccccagcaagggccgtccggacaagatcccgacgctgcgccccgcc
tttgccaaggacggcacgatcacggcggcgacctccagctccatctccgacggtgcggca
gctgtcgtggtggcgcgcgagagcgtggccagggacaagggccttacgccggtcgcgaag
atcgtgggcatgacagcccatgcgcaggctccggaagaattcaccatcgcccccgtcggc
gcgatcgagaagctgctggagcagaccggctggagcgcggatgacgtggacctgtgggaa
gtgaacgaggcgtttgcctgcgtgaccatgttcgccatgcaggacatcggcatcccgcac
gagaagatcaacgtgaacggcggcggcacggcgctgggccatcccatcggtgccagcggc
acgcgcatcctcgtcaccctgctcgcggccctgaaggcacgcggcggcaagcgcggcatt
gccagcctgtgcatcggcggcggcgaggcaaccgccgtggccgtggaactttgctag

DBGET integrated database retrieval system