KEGG   Altererythrobacter namhicola: A6F65_02446Help
Entry
A6F65_02446       CDS       T04447                                 

Gene name
zwf
Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
anh  Altererythrobacter namhicola
Pathway
anh00030  Pentose phosphate pathway
anh00480  Glutathione metabolism
anh01100  Metabolic pathways
anh01110  Biosynthesis of secondary metabolites
anh01120  Microbial metabolism in diverse environments
anh01130  Biosynthesis of antibiotics
anh01200  Carbon metabolism
Module
anh_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:anh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    A6F65_02446 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    A6F65_02446 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:anh04147]
    A6F65_02446 (zwf)
Enzymes [BR:anh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     A6F65_02446 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     A6F65_02446 (zwf)
Exosome [BR:anh04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   A6F65_02446 (zwf)
  Exosomal proteins of colorectal cancer cells
   A6F65_02446 (zwf)
  Exosomal proteins of bladder cancer cells
   A6F65_02446 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: ANU08727
UniProt: A0A1C7DBD4
Position
2467182..2468621
Genome map
AA seq 479 aa AA seqDB search
MVVSFKAKRLILFGATGDLSQRMLLPSLCALDADELLDPELKIIGTARSQLSDSEFRNFA
REAVEKYLPNGRRGRIADFINRLSYHPVDVTTPEGFKNLAEKAGGGEQPVAIFLSTAPSL
FEPTIQGLRDAGLAGEMSRISLEKPLGTDLQSSKEINDAVASAFSEDRIFRIDHYLGKET
VQNLIALRFANIMFEPLWNAQHIEHVQITVGETVGLESRVDFYDDAGALRDMVQNHMLQL
LALVAMEPPTHFYADAVRDEKVKVLRALRKVSAKEIVTGQYRAGAIDGKSVPGYDEELGK
DSDTETFVALKAHIDNWRWTGVPFYLRTGKRLPERVTEIVVQFRCIPYSIFTNAKTVPNR
LVIGIQPEENISLSLMAKVPGLDRDGMRLRSVPLDIAMPDAFVGAARRIAYERLLLDLIE
GNQTLFVRRDEVEAQWDWIDAIRQTWTEEGLTPKTYSAGTWGPSSAIALAERDGVTWHD
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggtagtgagcttcaaggccaagcggctgatcctgttcggcgcaaccggcgatctctcg
cagcgcatgctcctgccatccctgtgcgcgctggacgcggacgaactgctcgacccggag
ctgaagatcatcggtacagcccgctcgcagctttccgacagcgagttccgtaactttgcg
cgcgaggcggtggagaaatacctccccaacgggcgacgtgggcggatcgcggatttcatc
aaccggctgagttaccacccggtcgacgtgaccacgcccgaagggttcaagaacctggcg
gagaaggctggcggcggggaacagcccgtggccatcttcctcagcaccgcgcccagcctg
ttcgagcccacgatccagggcctgcgcgatgccgggctggcgggcgagatgtcccgcatc
agcctggaaaagccgctcggcaccgacctgcagagcagcaaggaaatcaacgatgcggtc
gccagcgccttctcagaagaccgcattttccgcatcgaccactacctgggcaaggagacc
gtccagaacctgatcgccctgcgctttgccaacatcatgttcgaaccgctgtggaacgca
cagcatatcgagcatgtgcagattaccgtgggcgaaaccgtgggcttggaaagccgcgtc
gatttctatgacgatgccggcgccctgcgcgacatggtgcagaaccacatgctgcaattg
ctggcgctggtggcgatggagccgcccacgcatttctacgccgatgcggtgcgcgacgag
aaggtgaaagtgctgcgcgccctgcgaaaggtttccgccaaggagatcgtgaccggccag
taccgcgcgggcgcgatcgacggcaaatccgtgcccggttatgacgaggaactgggcaag
gacagcgacaccgagaccttcgtggcgctgaaggcccatatcgacaactggcgctggacg
ggcgtgcctttctacctgcgcaccggtaagcggctgcccgaacgcgtgacggagatcgtg
gtgcagttccgctgcattccctattccatcttcaccaacgccaagaccgtgccgaacagg
ctggtcatcggcatccagccggaagagaatatctccctgtccctgatggccaaggtgccc
gggctggaccgtgacgggatgcggctccgctccgtaccgctggatatcgccatgcccgac
gctttcgtcggcgcggcgcggcgcatcgcatacgaacgcctgctgctggacctgatcgag
ggcaaccagacgctgttcgtgcggcgcgacgaggtggaggcccagtgggactggatcgat
gccatccggcagacctggaccgaggaaggcctgacgcccaagacctattccgccggcaca
tgggggcccagcagcgccatcgcgctggccgaacgcgacggagtgacctggcatgactga

DBGET integrated database retrieval system