KEGG   Aspergillus nidulans: AN0399.2
Entry
AN0399.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K02575  MFS transporter, NNP family, nitrate/nitrite transporter
Organism
ani  Aspergillus nidulans
Pathway
ani00910  Nitrogen metabolism
Module
ani_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AN0399.2
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ani02000]
    AN0399.2
Transporters [BR:ani02000]
 Major facilitator superfamily (MFS)
  Nitrate/nitrite transporters
   Nitrate/nitrite porter (NNP) family [TC:2.A.1.8]
    AN0399.2
SSDB
Motif
Pfam: MFS_1
Other DBs
NCBI-GeneID: 2876177
NCBI-ProteinID: XP_658003
UniProt: A0A1U8QEJ8 G5EB18
Position
VIII
AA seq 497 aa
MKPTQVLRLAVAAPDVNPQTRKARSIPVLNPFDLYGRVFFFSWIGFLVAFLSWYAFPPLL
SVTIKKDLHMSQDDVANSNIVALLGTFVMRFIAGPLCDRFGPRLVFVGLLICGAVPTAMA
GLVTTPQGLIALRFFVGILGATFVPCQVWCTGFFDKNIVGTANSLAGGFGNAGGGITYFV
MPAIYDSFVHDRGLTPHKAWRVSYIVPFIIIVSIALAMLFTCPDTPTGKWADREKTSGQS
IVDLSSTPNASSANSINISSDEKKAVHPEVTDSEAQVHVRAGQIESSDAVIEAPTIKRYL
SIALDPSALAVAVPYACSFGAELAINSILGAYYLLNFPLLGQTQSGRWASMFGLVNVVFR
PMGGFIADLIYARTNSVWAKKMWLVVLGLAMSGMAILIGFLDPHRESVMFGLVVLMAFFI
AASNGANFAIVPHVHPSANGIVSGIVGGMGNFGGIIFAIVFRYNGTQYHRSLWIIGFIIL
GCTLFFSWVRPVPKQNH
NT seq 1494 nt   +upstreamnt  +downstreamnt
atgaaacccacccaagtgcttcgcctggcggttgccgccccggacgtgaatccccaaacg
cgaaaggcccggtcaatcccggttctcaacccttttgatctttatggaagggtcttcttt
ttctcatggatcggattcctggttgcattcctctcctggtatgcgtttccgcctttgctg
agcgtcactatcaagaaagacctgcacatgtctcaggacgatgttgccaattccaatata
gttgccctcctgggaactttcgtgatgcggttcattgctggtccgctgtgtgatcgtttc
ggccctcggctggtttttgtcggactgttgatttgcggtgctgttcccacggccatggcg
ggccttgtcacaactcctcaaggtttgattgctttgcgattcttcgtgggcattctcggc
gcaacctttgtcccgtgccaggtatggtgcacgggattcttcgacaagaacattgttggt
actgccaactccttggcggggggttttggcaatgcaggcggcggcatcacctattttgtc
atgccggctatctacgactccttcgtccacgaccgcggcctaaccccgcacaaagcctgg
cgagtctcctacatcgtccctttcatcatcattgtctccatcgccttagccatgctcttc
acctgtcctgacacacccacgggcaaatgggcggaccgcgagaaaaccagcgggcaaagc
attgtcgacctcagttcaacgcccaatgcatccagcgccaacagtatcaacatctccagc
gacgagaaaaaggctgtccatccagaagtcaccgattcagaggctcaagtccatgtgcgc
gcgggacagattgagagttccgacgctgtgatcgaagcccccacgataaaacgctacctc
tccatcgcactagacccgtccgcccttgccgtcgcagttccttacgcctgctccttcggt
gccgaacttgccatcaactctatcctaggcgcgtactatctcctcaacttccctcttctt
gggcagacccaatcgggccgctgggcgtccatgttcggcctcgtcaatgttgtcttcaga
cccatgggtgggttcatcgcggatttgatctacgcgcgaacaaactccgtatgggccaaa
aagatgtggcttgtcgtgttggggctcgctatgtccggcatggccattctaatcggcttc
ctagatccgcatcgggaaagcgtcatgtttggtcttgtcgtacttatggcgtttttcatt
gcagcgagtaatggggcgaatttcgcaattgtcccgcacgtgcatccgtccgctaatgga
atcgtctccggtattgtcggtgggatgggcaacttcggcggcattatcttcgccattgtc
tttcggtacaatggaacgcagtatcaccgttcgctgtggattatcgggttcattatcctt
ggctgcaccctgttctttagctgggttagacctgttcctaaacagaaccactag

DBGET integrated database retrieval system