KEGG   Aspergillus nidulans: AN0595.2Help
Entry
AN0595.2          CDS       T01016                                 

Definition
(RefSeq) NCPR_ASPNG NADPH-cytochrome P450 reductase (CPR) (P450R)
  KO
K00327  NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ani  Aspergillus nidulans
Brite
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     AN0595.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_1 Flavodoxin_1 NAD_binding_1
Motif
Other DBs
NCBI-GeneID: 2876366
NCBI-ProteinID: XP_658199
UniProt: Q5BFT5
Position
VIII
AA seq 695 aa AA seqDB search
MAQLDTLDVVVLAVLLAGSIAYFTKGTFWAVAKDPYASSGPAMNGVAKAGKSRNIIEKMD
ETGKNCVIFYGSQTGTAEDYASRLAKEGSQRFGLKTMVADIEEYDYENLDQFPEDKVAFF
VLATYGEGEPTDNAVEFYQFITGDDVSFEGGGSAEDKPLSSLKYVAFGLGNNTYEHYNAM
VRQVDAALTKLGAQRIGSAGEGDDGAGTMEEDFLAWKEPMWAALSEAMNLQEREASYEPV
FCVTEDESLTPEDNSVYLGEPTKGHLEGQPNGPYSAHNPYIAPIVESRELFTVKDRNCLH
MEISIAGTNLTYQTGDHIAIWPTNAGAEVDRFLNVFGLEEKRHSVINIKGIDVTAKVPIP
TPTTYDAAVRYYMEVCAPVSRQFVSTLAAFAPDEETKTEIVRLGSDKDYFHEKITNQCFN
IAQALQSITSKPFSNVPFSLLIEGLNKIQPRYYSISSSSLVQKDKISITAVVESTRLPGA
THIVKGVTTNYLLALKQKQNGDPSPDPHGQTYAINGPRNKYDGIHVPVHVRHSNFKLPSD
PSRPIIMIGPGTGVAPFRGFIQERAALAARGEKVGPTVLFFGCRKRDEDFLYKDEWKVFQ
DQLGDSLKIITAFSRESEKKVYVQHRLKEHAELVSDLLKQKATFYVCGDAANMAREVNLV
LGQIIAAQRGLPAEKGEEMVKHMRSSGSYQEDVWS
NT seq 2088 nt NT seq  +upstreamnt  +downstreamnt
atggcacaactcgatactcttgatgtcgttgtcctcgcggtgctcttggcgggtagcatt
gcctacttcaccaagggcaccttctgggctgtcgctaaagatccctatgcgtcttccgga
ccggccatgaacggcgtggccaaggctggcaagtctcgcaacataattgagaaaatggac
gaaactggcaaaaactgtgttatcttttacggatcccaaactggaacggcagaggactat
gcctcgagattggcaaaggaaggatctcagcgattcggcctcaagacaatggtggccgac
atcgaagagtacgactacgagaatctggaccagtttcccgaagacaaggttgcgtttttt
gttctggctacttatggagagggtgagcctaccgataacgctgtcgaattctatcagttc
atcactggcgacgacgtgagtttcgagggtggtggctccgctgaggataagccgctgtcc
tccctcaagtatgtcgctttcggtctgggtaataacacgtatgagcactacaacgccatg
gttcgccaagtggacgctgccttgactaaactcggtgcgcaacgaattggctccgctgga
gagggtgatgatggcgctggtacaatggaagaagacttcttggcatggaaggaacctatg
tgggctgcgctttctgaggctatgaacttgcaggagcgcgaggcctcttatgaaccggtt
ttctgtgttacggaagacgaatcattgaccccagaggacaactccgtttacctcggtgag
cctaccaagggacatcttgaaggccaaccaaacggtccttactctgcgcacaacccctac
atcgcacccattgttgaatctcgtgagctgttcaccgtcaaagaccgcaactgcttgcac
atggaaattagcatcgctggaaccaacctcacttatcaaactggagaccatattgccatt
tggcccaccaacgcaggcgcagaggtggatcggttcctgaatgtctttggtcttgaggag
aagcgtcactcggtcatcaatattaagggaatcgatgttaccgccaaagttcctatccct
acgcctaccacctatgatgccgccgtccgttactacatggaagtctgtgctcctgtttct
cgtcagttcgtctcgactctggctgcttttgcccccgatgaggagactaagacggaaatt
gtacgcctgggtagcgataaggattacttccatgaaaagatcaccaatcagtgtttcaac
atcgctcaggctctgcagagcatcacctctaagcctttctccaatgtcccgttctccctg
ctcattgagggtttgaacaagatccagcctcgttattactcgatctcctcgtcttctctc
gtccaaaaggacaagattagcatcaccgcagttgtggagtctacccgcttgcccggggct
acccatattgttaaaggcgtgactacgaactatctccttgcactgaagcagaagcaaaac
ggtgacccttcgcctgaccctcatggccagacgtatgcgattaacggcccgcgcaacaag
tacgatggtattcatgttcccgttcatgtcagacattccaacttcaagctgccttctgat
ccttcgcgtcctatcatcatgattggtcccggtactggcgtcgctcctttccgtggtttc
attcaagaacgagctgctctggctgcccgtggtgagaaggttggtccaactgtcttgttc
tttggctgccgcaagcgcgacgaagatttcctatacaaggatgaatggaaggttttccag
gaccaacttggtgacagcctgaagattatcactgccttctcccgcgaatcggagaagaag
gtttacgtccagcaccggcttaaggaacatgccgagcttgtcagtgatctgctcaagcaa
aaggcgacattctatgtttgcggtgacgctgcgaacatggctcgcgaggttaaccttgtg
ctaggtcaaattatcgcggctcagcgtggtctgcccgccgagaagggagaggagatggtg
aagcatatgcgtagcagtggcagctaccaggaggatgtctggtcatga

DBGET integrated database retrieval system