KEGG   Aspergillus nidulans: AN0707.2
Entry
AN0707.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K12619  5'-3' exoribonuclease 2 [EC:3.1.13.-]
Organism
ani  Aspergillus nidulans
Pathway
ani03008  Ribosome biogenesis in eukaryotes
ani03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:ani00001]
 09120 Genetic Information Processing
  09122 Translation
   03008 Ribosome biogenesis in eukaryotes
    AN0707.2
  09123 Folding, sorting and degradation
   03018 RNA degradation
    AN0707.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ani03021]
    AN0707.2
   03019 Messenger RNA biogenesis [BR:ani03019]
    AN0707.2
   03009 Ribosome biogenesis [BR:ani03009]
    AN0707.2
   03016 Transfer RNA biogenesis [BR:ani03016]
    AN0707.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.13  Exoribonucleases producing 5'-phosphomonoesters
    3.1.13.-  
     AN0707.2
Transcription machinery [BR:ani03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     AN0707.2
Messenger RNA biogenesis [BR:ani03019]
 Eukaryotic type
  mRNA degradation factors
   5'-3' decay
    5' exonucleases
     AN0707.2
Ribosome biogenesis [BR:ani03009]
 Eukaryotic type
  Pre-60S particles
   RNases
    AN0707.2
Transfer RNA biogenesis [BR:ani03016]
 Eukaryotic type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    AN0707.2
SSDB
Motif
Pfam: XRN_M XRN_N zf-CCHC zf-CCHC_2
Other DBs
NCBI-GeneID: 2876473
NCBI-ProteinID: XP_658311
UniProt: Q5BFH3
Position
VIII
AA seq 1032 aa
MGVPALFRWLSKKYPKIISSVIEELPQEVNGEEIPVDITGPNPNGEEMDNLYLDMNGIVH
PCTHPEGKPPPANEQEMMIEIFKYTDRVVNMVRPRKLLMIAVDGVAPRAKMNQQRARRFR
SAQEAREQDEKKQEFQRMLAKQNGDKEQMLQEEVIQKTWDSNVITPGTPFMDILAASLRY
WIAYKLNTDPAWEKLKIIISDATVPGEGEHKIMEFIRSQRASPEHDPNARHVIYGLDADL
IMLGLATHEPHFRVLREDVFFQESKQRTCHLCGQPGHKAEECRGQAKEKNGEFDEKGKGA
TLKPFIWLHVSILREYLAAELYVPHQPFPFDLERALDDWVFMCFFVGNDFLPHLPSLDIR
EDGIDTLIAIWRDNIPLMGGYLTQDGRVDLKKAQLILQGLAKQEDAIFRRRRQAEERKLA
NEKRRKQEEKARNEERARKRRRSSPSYDAIESPTHAKPRSAGAAAAPPAGLELITPARGE
LARQTRELTHSMVVNRGNVYRANMANKSAAAVLKSKLLGGQDGQPSDDGESTAESDAQLD
AAGPVLGKRKADEAEVGQLGTETPDKPEPAKADELPPDTVRLWEEGYADRYYEQKFGVDP
QDKEFRHKVARAYAEGLAWVLLYYFQGCPSWTWYYPYHYAPFAADFVDIGDMELSFEKGT
PFKPYEQLMGVLPASSNHAIPKVFHSLMTEPDSEIIDFYPEDFPVDLNGKKFAWQGVVLL
PFIDEKRLLAAMSKKYPLLTEDEKARNTVGRDVLLLSESHPLYQDLVSNFYSKKQGAPKY
KLNMRVSDGLAGKVEKNEAYIPHSSLVSSLEEYGMPSLEDDRSIMVNYEIPKSTNIHKSM
LLRGVKFGPPALDNADIQATKSRAQHSGRSYGGAPFRGGRGGRMNYAGDRQSHGNDRPNP
FAAHLDPKFMPGANPGAPMGMPSGWVPPSGNFSRGPPPPPRGGTSYGYGSQQYGSYGGYG
QQQSYQQSSHSQSDYYGRGPPAPYNNGPADYYSGRPSGYGPQESRGGGYNRGGYRGGRDT
YSSSGHGGYGRY
NT seq 3099 nt   +upstreamnt  +downstreamnt
atgggtgttccggctttgttcagatggctctccaagaaatatccgaagattatctcctcg
gtaatcgaggaactgcctcaggaggtcaatggagaagaaattccggttgacatcaccggc
ccaaatccaaatggcgaagagatggataatctgtatctcgatatgaacggcattgtccat
ccgtgtacacatccagagggcaagccgccacccgccaatgagcaggagatgatgatcgag
atttttaaatacacagatcgggtcgtgaatatggtccgccctcggaagctcctgatgatt
gccgtcgatggtgttgccccccgcgcaaagatgaaccaacagcgagcacgtcgattcagg
tccgctcaagaagctagagaacaagacgagaagaaacaggagttccagagaatgcttgcg
aaacagaacggggacaaagaacaaatgctccaggaagaagtcatccagaagacatgggac
agcaacgttatcactcccggaacaccgttcatggacatccttgcagcgtccctgcggtac
tggatagcttacaagctcaacactgatcctgcctgggaaaagttgaaaatcatcatctcc
gatgccacagtgcccggtgaaggtgaacataagatcatggaattcatccgctcgcagcgc
gcttcgcctgaacatgacccaaatgctcgtcatgttatttacggattggacgcagactta
attatgttaggtctggctactcacgagccccactttagagtgttgcgagaggatgtgttc
ttccaggaatccaaacagcggacatgtcatctctgcggtcagcctggccataaagcggag
gagtgcagaggtcaagccaaagagaagaacggagagttcgacgaaaaaggaaaaggtgca
acactcaagccgtttatctggctccatgtttcaatccttcgagaatatcttgcggcggaa
ctttacgtcccgcaccaaccgttcccgtttgatcttgagagggcgctagatgactgggtt
ttcatgtgtttttttgtaggaaacgatttcctcccgcacttgccgtctttggacattcgt
gaggatggtatcgacactttgattgcaatctggcgtgataacatccccctaatgggtgga
tatctgactcaggatgggcgcgtggacctaaagaaagctcagcttattctccaaggtctc
gctaagcaagaagatgctatctttcgccgtcgtaggcaggcagaagagaggaagcttgcc
aacgagaagagacgcaagcaagaagaaaaggcacgcaatgaggagcgcgccaggaaaaga
aggcgaagctctccctcttacgatgcgattgaatcacccactcatgctaagccgcgcagt
gctggtgcagctgcagcgccgccagctggccttgagctgatcacccctgccagaggtgaa
ctggcccgtcagacccgagagctgactcatagtatggtggtcaatcgcggcaacgtctat
cgggccaatatggctaacaagagcgcggccgctgtcttgaaaagcaaactactgggaggg
caggatggccagccctctgacgatggagagtcaaccgctgagtcggacgcacaacttgac
gctgcaggacctgttctcggcaaacgaaaggcagatgaggcagaggtcggacagctcggt
actgagacaccagacaagccggaacccgcgaaggcggatgagctgccgccagacacagtc
cgtctgtgggaagaaggatacgcagaccgatattatgaacaaaagtttggcgttgaccca
caggacaaggagttccgtcacaaggttgcgagggcgtacgccgaaggcctcgcttgggtt
ctgttatattatttccaagggtgcccgtcctggacttggtactacccgtaccattacgcg
cctttcgctgcagactttgtggatattggtgacatggagttatcgtttgagaaaggtact
ccatttaagccttacgagcagcttatgggcgttctccctgcgtcctcgaatcatgctata
ccaaaggtgttccactcattaatgaccgagcccgatagcgagattatcgacttctacccc
gaggatttcccggtcgacctgaacggcaagaagtttgcctggcaaggtgtggtcttgctg
cccttcattgacgaaaagcgacttctggctgccatgtccaagaaatatccccttttaact
gaggatgaaaaagctcgcaacaccgtgggtcgggatgtgctgctattatcagaaagccac
ccgctttatcaagatctcgtctcaaatttctactctaagaagcaaggcgctccaaagtac
aaactcaacatgcgggtgagcgatggacttgcaggcaaggttgaaaagaacgaggcgtac
attccgcacagctccctcgtgtcatctctggaggagtatggtatgccatcattggaggat
gaccgttcgataatggtcaattacgagataccgaaatccaccaacattcataagtccatg
cttctacggggagtgaaattcggtcctccagccttggacaatgcagatatccaggctact
aaatctagagcccagcactccggacgctcgtacggcggagcgcctttccgtggcggacga
ggaggacgtatgaattatgccggtgacagacaaagccatggcaacgatagaccaaacccg
tttgcggcacaccttgatcccaagtttatgcctggagccaaccccggggctccgatgggg
atgccctctggttgggttcctccctctggcaatttttcgcgggggccgccgcctcctccc
cgtggaggaacatcctatggatacggctcgcagcaatatggttcttatggtgggtatgga
cagcagcaaagctatcaacaatcaagccacagtcaaagcgactattatggtcggggtccg
ccagcgccctacaacaatggcccggctgattactacagtgggcgcccatcaggctatggg
ccgcaagaatctcgaggcggaggctacaaccgtggcggttacagaggcggccgagacact
tattcctcaagtggccatggcggatacggccgatactag

DBGET integrated database retrieval system