KEGG   Aspergillus nidulans: AN0806.2
Entry
AN0806.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K24758  WD repeat-containing protein 89
Organism
ani  Aspergillus nidulans
Brite
KEGG Orthology (KO) [BR:ani00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:ani04990]
    AN0806.2
Domain-containing proteins not elsewhere classified [BR:ani04990]
 WD40 repeat (WDR) domain-containing proteins
  Other WDR domain-containing proteins
   AN0806.2
SSDB
Motif
Pfam: WD40 Nucleoporin_N
Other DBs
NCBI-GeneID: 2876585
NCBI-ProteinID: XP_658410
UniProt: Q5BF74 A0A1U8QLH2
Position
VIII
AA seq 360 aa
MHMLKQISSSSLGLPEDSYIYSIVPSSRTGFAAISSDDSLRIFDANELSHASLVASNVHD
GVTSLRTYDASNQLVVTGGRDGKVKLWDLRNGKKSAVVAVQSSNQAPVLSTANCSETNSI
VAGTELHSHQAIVAFWDVRSPNQPRLEYVESHNDDVTELQYHPNRHNILLSGSTDGLVNI
YNTTITDEDEALVQVINHGSVHRAGFINERTIYALSHDETFSIHPATDPDEEAQEPEPIQ
FGDLRQPLNCEYIAQLCLGSQGPYIAAGNKVDKRLDLIPLAQSPSWRFDEQNLWRLPGGH
GEEVVRSIHIDEQNQSVFTCGEDGLVRAWKPEGEQGQEAQMGTPRHKEKKTKEKARYKPY
NT seq 1083 nt   +upstreamnt  +downstreamnt
atgcatatgctcaagcaaatcagctcttcctcattgggcctgcccgaggacagctacatt
tactcgatcgtgccgtcctctcgcacagggttcgcggccatctcatctgatgactcgcta
cgcatattcgacgcgaacgaacttagtcatgcgtcgttagtggcctccaatgtacacgat
ggagtcacatcattgcggacgtatgacgcgagcaatcagctagtggtcactggaggaaga
gatggcaaagtgaaattgtgggatctccgcaatggcaagaaatccgcagttgttgcggtg
caatcatcgaatcaggcacctgtgttgtccacagccaactgctccgaaaccaacagcatc
gtcgcggggacggaactgcattcccaccaggcaattgttgcattctgggatgttagatcc
ccaaaccagccacgtctcgaatacgtggaaagccacaacgacgacgtaactgagcttcaa
taccacccaaaccgccacaacatcctgctttcaggaagtaccgatggcttggttaacatc
tacaacacaacaatcactgatgaggacgaggctcttgtgcaagtgatcaaccatggctct
gtgcatcgtgccggctttatcaatgagcgaaccatctacgccttgagccatgacgagacg
ttctcgatccacccagctacagatccagacgaggaagcgcaggagccggagccgattcaa
ttcggcgacctgagacagcctctcaactgcgagtacattgcgcagctctgcctcggcagc
caggggccatatatcgccgcgggtaataaagttgataaacgtctcgacctgattcccctc
gcacagtctccctcgtggcgcttcgacgagcagaatctatggcgcctccccggcggtcat
ggcgaggaagtcgtgcgctccatccacatcgatgagcagaatcaatccgtgtttacctgt
ggcgaggacggccttgtgcgtgcttggaagccagagggcgaacagggtcaggaagcccaa
atggggacgccgcggcacaaggagaagaagaccaaggagaaggcacgatacaagccatac
taa

DBGET integrated database retrieval system