KEGG   Aspergillus nidulans: AN1007.2
Entry
AN1007.2          CDS       T01016                                 

Definition
(RefSeq) NIR_EMENI Nitrite reductase
  KO
K17877  nitrite reductase (NAD(P)H) [EC:1.7.1.4]
Organism
ani  Aspergillus nidulans
Pathway
ani00910  Nitrogen metabolism
ani01100  Metabolic pathways
Module
ani_M00531  Assimilatory nitrate reduction, nitrate => ammonia
ani_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AN1007.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.1  With NAD+ or NADP+ as acceptor
    1.7.1.4  nitrite reductase [NAD(P)H]
     AN1007.2
SSDB
Motif
Pfam: Pyr_redox_2 NIR_SIR Pyr_redox Rieske_2 Rieske Fer2_BFD NIR_SIR_ferr Rubredoxin_C FAD_binding_2 Rep_N
Other DBs
NCBI-GeneID: 2876784
NCBI-ProteinID: XP_658611
UniProt: P22944
Position
VIII
AA seq 1104 aa
MPLLDGPRNGETVTASAHNGIPIIDGVDPSTLRGDIDQDPNRRQKIVVVGLGMVAVAFIE
KLVKLDSERRKYDIVVIGEEPHIAYNRVGLSSYFEHRKIEDLYLNPKEWYGSFKDRSFDY
YLNTRVTDVFPQHKTVKTSTGDIVSYDILVLATGSDAVLPTSTPGHDAKGIFVYRTISDL
ERLMEFAANHKGQTGVTVGGGLLGLEAAKAMTDLEDFGSVKLIDRNKWVLARQLDGDAGS
LVTKKIRDLGLEVLHEKRVAKIHTDDDNNVTGILFEDGQELDCCCICFAIGIRPRDELGG
STGIQCAKRGGFVIDESLRTSVNDIYAIGECASWENQTFGIIAPGIEMADVLSFNLTNPD
KEPKRFNRPDLSTKLKLLGVDVASFGDFFADRDGPKFLPGQRPSAESIGAADPNREEEPQ
VKALTYRDPFGGVYKKYLFTMDGKYLLGGMMIGDTKDYVKLNQMVKSQKPLEVPPSEFIL
GAQSGGEENADDLDDSTQICSCHNVTKGDVVESVKSGTCKTIADVKSCTKAGTGCGGCMP
LVQSIFNKTMLDMGQEVSNNLCVHIPYSRADLYNVIAIRQLRTFDDVMKSAGKCPDSLGC
EICKPAIASILSSLFNPHLMDKEYHELQETNDRFLANIQRNGTFSVVPRVPGGEITADKL
IAIGQVAKKYNLYCKITGGQRIDMFGARKQDLLDIWTELVDAGMESGHAYAKSLRTVKSC
VGTTWCRFGVGDSVGMAIRLEQRYKSIRAPHKFKGAVSGCVRECAEAQNKDFGLIATEKG
FNIFVGGNGGAKPRHSELLAKDVPPEEVIPILDRYVIFYIRTADKLQRTARWLESLPGGI
EYLKDVVLNDKLGIAAEMERQMQELVDSYFCEWTETVRNPKRRKYFQQFANTDETVENVE
IVKEREQVRPTYWPKDGANEDFKGHQWSSLSWQPVIKADYFSDGPPAISSANIKRGDTQL
AIFKVKGKYYATQQMCPHKRTFVLSDGLIGDDDNGKYWVSCPYHKRNFELNGEQAGRCQN
DEAMNIATFPVEEREDGWIYMKLPPVEELDSVLGTEKWKVKKGEAVDPFEAYDKKYSGMK
GKRAGAKGIEGSKPTRSPSNTIDW
NT seq 3315 nt   +upstreamnt  +downstreamnt
atgccgttgctggacggtccccggaacggtgagactgtcactgccagtgctcataatggc
atccctattattgacggagtcgacccttccacacttcgaggcgacattgaccaagacccc
aacaggcggcagaagatcgtcgtcgtggggttgggcatggttgccgttgcattcattgag
aaactcgtcaagctagattcagagagacgcaagtacgatatcgtcgtgattggagaagag
ccgcatattgcctacaaccgtgtaggtctgtcgtcgtacttcgagcaccgcaagatcgaa
gatctatatctgaacccgaaagaatggtacggctcattcaaggaccgatcgttcgactac
tacctcaatacccgagtgaccgatgtttttcctcaacacaaaaccgtcaagacctcaacc
ggtgacattgtttcgtacgatatccttgttctcgctactgggtcagacgccgtgcttcct
actagcacgcctggtcatgatgccaaggggatctttgtttatcgtaccatttccgacctt
gaacggctcatggagtttgcggccaatcacaagggccaaaccggtgtcacagtgggaggc
ggtttactcggccttgaagctgccaaggccatgacagatctcgaagactttggcagtgtc
aaattaatagaccgcaacaaatgggtgctggccagacagctggatggcgatgccggttcc
cttgtgactaagaagatcagagacctcggtttggaggtgctccacgagaaacgggtggct
aagattcatactgatgacgacaacaatgtgactggtattctcttcgaggacggccaggag
cttgattgttgctgtatctgttttgctattggcattcgaccgcgagacgagctgggagga
agcaccggtattcaatgcgcaaagcgtggcggcttcgtcattgacgaaagcttgcgaaca
tcggttaatgacatttacgctattggcgagtgtgctagctgggaaaaccagacttttggt
atcattgctcctggtattgagatggccgatgtgctatcatttaacttgacaaacccggac
aaggaaccgaagagattcaacaggccggacctaagcaccaaactcaagctgttaggagtc
gatgttgccagttttggtgactttttcgccgacagagatggaccgaaattccttccaggg
caacgaccgtctgccgaatctattggagctgcagaccctaaccgtgaagaagaacctcag
gtcaaggccctcacgtatagagatccttttggcggagtctacaagaagtacctgtttacc
atggatggaaaataccttcttggcggtatgatgattggcgataccaaggattatgtcaag
ctgaaccagatggtgaagtcacagaagcctctggaagtaccacccagtgaattcatcttg
ggtgcccagagcggtggagaagaaaatgcagacgatcttgatgacagcactcagatttgc
tcgtgtcacaatgtaaccaagggcgacgtggtagagagcgtcaagagcggcacttgcaag
acgatagcagacgttaagtcatgcaccaaggcaggaacgggttgtggtggctgtatgcct
ctagtgcagtccatcttcaacaaaaccatgctggacatgggtcaagaagtctcaaacaac
ctgtgtgtccatattccatactcgcgggcggacctttacaatgtcatagctatccgtcaa
ttaagaacctttgacgatgtgatgaagtcggctggaaagtgcccagactcgctaggatgt
gagatctgtaagccggcaattgcgtctatcctctccagtctcttcaacccccaccttatg
gacaaagaatatcacgaacttcaagagaccaacgatagattcctcgccaacattcagaga
aatgggactttctcggttgtccctcgagttcctggaggtgaaatcacagccgacaagttg
attgcaattgggcaggtagccaagaaatacaatctttactgcaagatcacaggtggtcag
cgtatcgatatgtttggtgccaggaagcaggatctactcgatatttggactgagctcgtc
gatgccggtatggagagtggccatgcgtacgccaagtcactccgaactgttaagagttgt
gttggaacaacctggtgccgattcggcgtcggagacagcgttggaatggctatccgcttg
gagcaacggtataagagtatccgagctccacacaagttcaagggtgctgtctctggctgt
gtccgagagtgtgccgaagctcaaaacaaggactttggtcttattgctaccgagaaggga
ttcaatatcttcgttggtggcaacggaggtgccaaaccccgtcattcagagttacttgcc
aaggatgtaccacctgaggaggtgattccgatcctggatcgctacgtgatcttctacatc
agaactgcagacaaactccagcgaacggcgagatggctcgagagccttccgggcggcatt
gaatacctcaaggacgttgttctcaatgataaacttggaatagcagcagagatggagcgt
caaatgcaggagctggttgacagctacttctgcgaatggaccgagacagtcagaaatccc
aaacgtcgcaagtacttccaacaattcgccaacactgacgagacggtcgagaacgtggaa
attgttaaggagcgcgagcaagtgcgcccgacttactggcccaaggacggagccaacgaa
gacttcaagggtcaccaatggtccagcctctcgtggcagccagttatcaaggctgactac
ttctccgacggcccacccgcaatctcgtccgccaatatcaagcgcggtgatacccaattg
gccattttcaaggtcaagggcaagtactacgctacacaacaaatgtgccctcacaagcga
acctttgtcttgtccgacggtctgattggcgacgacgacaacggcaaatactgggtatcg
tgtccgtaccacaagcggaacttcgaactcaacggcgagcaggctggccgttgccaaaac
gatgaggcgatgaatattgccacattcccagttgaggagcgggaagatggctggatttac
atgaaacttccaccagttgaggagctggattccgttcttggtacggaaaagtggaaggtg
aagaagggtgaagctgtggacccgtttgaggcgtatgacaagaagtacagcgggatgaaa
gggaagagagccggcgccaagggaattgagggcagcaagcccactcggtctccttcaaac
acaatagactggtag

DBGET integrated database retrieval system