KEGG   Aspergillus nidulans: AN1094.2Help
Entry
AN1094.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K17871  NADH:ubiquinone reductase (non-electrogenic) [EC:1.6.5.9]
Organism
ani  Aspergillus nidulans
Brite
KEGG Orthology (KO) [BR:ani00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AN1094.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.5  With a quinone or similar compound as acceptor
    1.6.5.9  NADH:ubiquinone reductase (non-electrogenic)
     AN1094.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox Pyr_redox_3 TALPID3 Com_YlbF
Motif
Other DBs
NCBI-GeneID: 2876871
NCBI-ProteinID: XP_658698
UniProt: A0A1U8QQW4 Q5BED6
Position
VIII
AA seq 570 aa AA seqDB search
MVGSTLAMRSNAMQLSSLSRRSLTTRSPVQALRSSQSLSLRTARRPYSDAAPLPAPKPKK
RFRFLRWTWRLTLLAGVGLAGNLAYNIYDQRHPTEQFVPDPSKKTLVILGTGWGSVSLLK
KLDTENYNVVVISPRNYFLFTPLLPSCTTGQVEHRSIMEPIRSILRHKKAHVKFYEAEAT
KVDYEKRIVYISDDSEIKGDISHTEVPFDMLVMGVGAENATFGIKGVKENSCFLKEVGDA
QRIRKRIMDCVETAMFKDQSEEEIKRLLHMVVVGGGPTGVEFAGELQDFFEHDLRKWVPE
IQENFRVTLVEALPNVLPMFSKQLIDYTESTFKEESITIRTKTMVKNVTDKYIEAEVTKP
DGTKELETIPYGLLVWATGNAIRPIVRDLMSQLPAQKNSRRGLAVNEYLVVNGTENVWAV
GDCAITNYAPTAQVASQEGAFLARLFNTMAKTEAIEKELQRLSEAQSAAKSEEERNKIFD
EIRDHQRQLRRTKQIGPFQYSHQGSLAYIGKERAVADISWLSGNIASGGTMTYLFWRSAY
LSMCFSTRNRVLVALDWVKAKLFGRDVSRE
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atggttggaagtacgctggctatgcggtcaaacgccatgcaattgtcgtcgctgtcgcgc
aggtcgctcacgacgcggtcgcccgtccaggctctgcggtcatcacaatcgctgagtcta
cgcactgctcgtcgtccctattccgacgctgcacctctcccagctcccaagcccaagaag
cgatttcgattcctgcgctggacgtggcgtctaaccttgttggctggtgttggtctggcc
ggtaacctcgcttacaacatctacgaccaacgtcacccgaccgagcaattcgtacctgat
cccagcaagaagactcttgtgattctcggaaccggctggggatccgtttctcttctcaaa
aaactcgacacagaaaactacaatgtcgtcgtcatctcgccccgtaactacttccttttc
actcctctgctgccgtcatgcacaactggccaggtcgagcaccgctctatcatggagccc
atccgaagcattctccgtcacaagaaagcccacgtcaagttctacgaagccgaggccaca
aaggtcgactatgagaagcgcattgtatacattagtgatgactcggaaatcaagggcgac
atctcccacaccgaggttccctttgacatgcttgtcatgggtgttggtgcggaaaacgct
acttttggtatcaagggtgtcaaggagaactcttgcttcctgaaggaggttggcgatgcc
cagaggatccgcaagcgcatcatggactgtgttgagactgccatgttcaaggatcagtct
gaggaagagatcaagcgtcttctgcacatggttgtcgttggtggcggcccgaccggtgtt
gaattcgctggtgagctgcaagacttcttcgagcacgatctgaggaagtgggttcctgag
atccaggagaacttccgcgtcacccttgttgaagctctgcccaacgtgcttcctatgttc
tccaaacagctgattgactacacggaatcgacgttcaaggaggaatccatcacgatccgc
accaagacgatggtcaagaacgtcacagacaagtatatcgaagccgaggtcaccaagccc
gacgggaccaaggagctcgagaccattccatacggtctgcttgtttgggctaccggtaac
gctatccgtcccatcgttcgcgatcttatgagccagctccccgcccagaagaactcgcgt
cgtggtcttgctgtcaacgaataccttgttgtgaacggtactgagaatgtctgggctgtc
ggagactgtgccatcaccaactacgcccctaccgcccaggttgccagtcaggagggcgct
ttcctcgcccgccttttcaacaccatggccaagaccgaggccatcgagaaagagttacag
agactatctgaagctcaatcagccgccaagagcgaagaagagcgcaacaagatcttcgac
gaaatccgtgatcaccagcgccaactgcggcgaaccaagcaaatcggcccgttccaatac
tcccaccagggaagcctggcctacattggaaaggagcgtgcggttgcagatatcagctgg
ctgagcggcaacatcgcaagtggtggaactatgacctatctcttctggcgtagtgcttat
cttagcatgtgcttcagcacccgcaatcgtgtcctagttgccctcgactgggtcaaggcc
aagctctttggtcgtgacgtgtctcgcgagtaa

DBGET integrated database retrieval system