KEGG   Aspergillus nidulans: AN1266.2
Entry
AN1266.2          CDS       T01016                                 
Name
(RefSeq) hypothetical protein
  KO
K12811  ATP-dependent RNA helicase DDX46/PRP5 [EC:3.6.4.13]
Organism
ani  Aspergillus nidulans
Pathway
ani03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ani00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    AN1266.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ani03041]
    AN1266.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     AN1266.2
Spliceosome [BR:ani03041]
 Complex A
  U2 snRNP components
   U2 related factors
    AN1266.2
 Complex B
    AN1266.2
SSDB
Motif
Pfam: DEAD Helicase_C ResIII
Other DBs
NCBI-GeneID: 2877043
NCBI-ProteinID: XP_658870
UniProt: Q5BDW4
Position
VIII
AA seq 1173 aa
MARHGDTRSPSPVGSTYSSSRRSRRDDDRYERKRDDGRSYRRSRSPERRYRERDRDRDSY
RRRDHSVDRRDSHRDEDNYRRRDRSRDRRRSRDRDHDRDYRRRSRSRDRDYRSRRDDSRD
RVRRRTDDSADLKRKSRRDDSRDRTRGAEPKSREASTPAIPTRTGPTDDEKRAERLAKLE
AWKQKQAAEKERKQKEAEASGGPRNILEEIDRKSGLSPAVSSPQSPATQGVDAAPAAYAG
KFDPKAIAKNAAQTPAAPSVLGNDVAVPSSAKTSNAQTARVQASKASGNAPSPAVLKAKG
NVGSFGLGTKQVADNEKSIATKTLGFGEEESTRRKLERLPTPPLDDADASKTAETNADDD
DDVDMQDGETEEDAAAAARVAAERREERLQNESLTKTTNGNTTAKAEEADKMEVDAQEEE
LDPLDAFMSELAESAPPKKKAGAKFSKAQEPEAIFGDEHDVSMTAVGEGDAEDFLAIASK
AKKKKDIPTVDHNKVEYEPFRRKFYTEPSDLAQMSEEEAANLRLELDGIKVRGLDVPKPV
QKWSQCGLGIQTLDVIDKLGFASLTSIQAQAIPAIMSGRDVIGVAKTGSGKTMAFLIPMF
RHIKDQRPLENMEGPIGLIMTPTRELATQIHKDCKPFLKALNLRAVCAYGGAPIKDQIAE
LKRGAEIIVCTPGRMIDLLAANAGRVTNLRRVTYVVLDEADRMFDMGFEPQVMKILSNVR
PDRQTVLFSATFPRNMEALARKTLTKPIEIVVGGRSVVAPEITQIVEVCNEEKKFVRLLE
LLGNLYSTDENEDARSLIFVDRQEAADTLLRELMRKGYPCMSIHGGKDQIDRDSTIEDFK
AGIFPVLIATSVAARGLDVKQLKLVVNYDAPNHLEDYVHRAGRTGRAGNTGTAVTFLTED
QERYSVDIAKALKQSGQEVPEAVQKLVDSFLEKVKAGKEKASNSGFGGKGLERLDQERDA
ARMRERRTYKTGEEGEDEEEKDEKKNEQAEEQFNKVLSAVQSTSAQLPGVPKGIDLDGKI
TVHKREVDPNAPNNPLDKVGSAVADIHARLSRAGVMRSGVPIDNRGPDAGAFHATLEIND
FPQKARWAVTNRTNVAKILEATGTSITTKGSFYPAGKEPGPGENPKLYILVEGETELSVT
NAMRELMRLLKEGTIAAVDSESRAPASGRYSVV
NT seq 3522 nt   +upstreamnt  +downstreamnt
atggctcgccatggggatactcgctcaccatcgcctgtaggcagcacatattcatcatca
cgacgcagtcgcagagatgatgaccgctatgagcggaagcgagacgatggccggagttac
cgcaggtctcgtagtcctgagcggcgatatcgtgaacgagaccgtgaccgcgattcatac
cgaagacgtgaccactctgtagacagacgcgacagtcaccgcgacgaagacaactataga
cgacgagaccgctcccgagatcgccgccgctcaagagatagagatcacgaccgcgactat
cgccgaaggagccgcagccgtgatagagattaccggagcaggcgagatgactcccgcgat
agggtccgaagacggacagacgattctgctgacttgaagcgcaagtctagacgggacgat
agccgagatcggaccaggggcgcagagccaaagtctcgcgaggcctcgacacctgcgatc
cccactcgcactgggcctacggatgacgaaaaaagagctgagcgactggcgaagctcgaa
gcatggaagcagaagcaagctgctgagaaagaacgaaagcagaaagaagctgaagcttct
gggggaccaagaaatatcttggaagagattgatagaaagtctggattatccccagccgtt
agttcaccccagtctcctgccacgcaaggcgttgatgccgccccagctgcatatgctgga
aaattcgatccgaaggccatcgcaaagaatgctgctcagaccccggctgctccttcagtc
ctggggaatgatgtggctgttccgtcctctgccaaaacttcgaatgcccagacagccagg
gtgcaagccagcaaagcttcaggcaacgccccctctccagccgtcttgaaagcaaaaggc
aatgtaggaagcttcggacttggcaccaagcaagtagcggataatgagaagtccatcgcc
actaagacgctaggattcggtgaagaggaatcaactcgaagaaagctcgaacgcctgcca
acaccgccgctagatgatgcggacgccagtaaaacagcagaaacgaatgcggatgatgac
gacgatgttgatatgcaagatggggagaccgaagaggatgctgccgctgctgctcgtgta
gccgctgaacggcgagaagaacgtctacagaacgaatctcttactaagacaaccaacggc
aacacgacggcgaaagcagaagaagctgataagatggaagtcgacgctcaggaggaagag
cttgatccattggacgcattcatgtctgaacttgccgagtctgctccgccgaaaaagaaa
gctggtgccaagttctccaaggcacaagaacctgaagctatctttggcgatgagcatgat
gtgagcatgactgctgtcggtgaaggtgatgcggaagacttccttgccattgccagtaag
gctaagaaaaagaaagacattccgactgttgaccacaataaggtggagtatgaaccgttc
cgacggaagttctataccgaaccctccgacttggctcagatgtctgaagaagaagcggct
aatctgcggcttgaacttgatggcatcaaagtccgtgggttggatgttcctaaacctgta
cagaaatggtctcagtgcggcctagggatacagacgctggacgtcattgacaagcttggc
tttgccagtttaacttctattcaagcccaagcgatcccagccattatgtccggtcgtgat
gtgattggtgtggccaagacaggatccgggaaaacaatggcgttcttgatacccatgttt
cggcatatcaaagaccagcggccgctggaaaatatggaaggcccgataggtttaattatg
acgcctacccgagagttggcgacacagattcataaggactgcaaaccattcttgaaagct
ttgaatctacgagctgtttgtgcttacggaggtgctcccatcaaggatcaaatcgccgaa
ttgaaacgcggagcggaaatcattgtatgcacaccgggacggatgattgatcttttggca
gcgaacgctgggcgagttacgaacctgcgccgggtcacttacgttgttttggatgaggct
gaccgtatgttcgacatgggatttgagcctcaggtcatgaaaattctgagcaatgtgcgt
ccagaccgacagactgtgctgttctccgctaccttcccgcgaaacatggaagcgttggct
cgcaagactctaaccaagcccatcgaaatcgtcgtgggcggtaggagtgtcgttgcgcct
gagattacgcagattgtcgaagtttgtaacgaagagaagaaattcgtccgcctactagaa
ttactaggtaacctgtattctacggacgagaatgaagacgcgcggtcgttgattttcgtc
gatcgccaggaagcggccgacactcttctccgagagttgatgcgtaaaggttacccttgc
atgtctattcacggcgggaaggaccaaattgaccgtgattctaccatcgaagatttcaag
gctggcatctttcccgtgctgattgcgacctctgtagctgcacgtggcttggatgtcaaa
cagctgaagcttgtcgtcaactacgatgcgccgaaccatttggaggattatgttcaccgt
gctggacgtactggtcgtgcagggaacacgggaaccgcagtcactttccttacggaggac
caggaacggtattcggtcgatattgctaaagcgctcaagcaaagtggacaagaagtccca
gaagccgtacaaaaacttgttgactcgttcttggagaaagtaaaagccggtaaagagaag
gccagcaactctggcttcggtggaaagggtctggagcgattggatcaagaacgtgatgcg
gctcggatgcgcgagcgtcgcacatacaaaaccggagaagagggcgaagatgaggaagag
aaggatgaaaagaagaacgaacaggccgaagagcaattcaacaaggttctctcggctgtc
cagtctacctctgcgcagctacccggcgttccaaaaggcatcgatctggatggcaagatc
acagttcacaagagagaagttgatccgaatgctcctaacaatcctcttgataaggttggc
tcggctgttgcagatatccacgcacggctcagccgtgctggagtcatgcgatcaggcgtg
cctattgacaatcgcggtcctgatgccggtgcgttccatgcgacactggagatcaacgac
tttcctcagaaagctcgatgggcggtcacaaaccgcacgaacgtggccaagatcctcgaa
gctaccggcacgtctattacgacaaagggcagtttctatcccgccggtaaagagcccggt
ccgggagagaacccaaagctgtacattttggtggaaggtgaaaccgagctgtctgtgacg
aatgcgatgcgggagttgatgcgcttgttgaaggagggcacgattgccgcggtggacagc
gagtctcgggctccggcatcaggccgatacagtgtggtatag

DBGET integrated database retrieval system