KEGG   Aspergillus nidulans: AN1273.2Help
Entry
AN1273.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K19668  cellulose 1,4-beta-cellobiosidase [EC:3.2.1.91]
Organism
ani  Aspergillus nidulans
Pathway
ani00500  Starch and sucrose metabolism
ani01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AN1273.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.91  cellulose 1,4-beta-cellobiosidase (non-reducing end)
     AN1273.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_6
Motif
Other DBs
NCBI-GeneID: 2877050
NCBI-ProteinID: XP_658877
UniProt: Q5BDV7
Position
VIII
AA seq 435 aa AA seqDB search
MQIEFYQGRRRHCSAWAFLDRFGIGVPGRDSILSISMRALATMLTLGAVSVNALPQATST
PAGTPSSSGIPVQATGNPFEGYQLYANPYYSSEVMTLAVPSMTGSLAEQATHAAEIPSFH
WLDTTAKVPTMGEYLADIKEQNDAGANPPIAGIFVVYNLPDRDCAALASNGELSIADGGV
EKYKEYIDAIRAHAVEYSDTNIILIIEPDSLANLVTNLNVEKCANAQDAYLECTNYAITQ
LDLPNVSMYLDAGHAGWLGWPANIGPAAQLFAGVYQDAGAPAALRGLATNVANYNAFSID
TCPSYTSQNAVCDEKGYINSFAPELSAAGWDAHFIVDTGRNGKQPTGQIEWGDWCNVKGT
GFGVRPTTDTGDELVDAFVWVKPGGESDGTSDQSAERYDAHCGAAAALQPAPEAGTWFQA
YFEQLVANANPPLSS
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgcagattgaattttaccagggcagaaggcgtcattgctccgcctgggcgttccttgat
cgtttcggtattggagttccaggtcgcgattccatcctatctatcagtatgagagcattg
gcgacaatgctgacccttggggctgtgagcgtgaacgctctgccacaggctacaagcaca
cctgctgggacgccgagtagctctggaatacctgtgcaggcaaccggaaatccgttcgag
ggataccagctctacgccaacccgtactacagctccgaagttatgactctggctgtcccg
tcaatgactggttcattggccgagcaggcgacccatgccgctgagattccatcgttccat
tggctggatacgacggccaaggttcctaccatgggcgagtatctggcggacatcaaggag
cagaatgacgcgggagccaacccaccgattgccggtatttttgttgtttataacttgcca
gaccgtgactgtgcggccctggccagcaatggagagctttcaattgccgatggaggcgtt
gagaagtacaaggagtatattgatgctattcgcgcgcatgccgtggagtattccgacacc
aacataatccttattattgagcctgacagtctggcaaatctggtgaccaacttgaatgtg
gagaagtgtgccaatgctcaggatgcttacctcgaatgcacaaactacgccattacccag
ttggatctccccaacgtatctatgtaccttgacgctggtcatgccggatggctgggatgg
cccgcaaacatcggcccagcagcccagctctttgcgggtgtttaccaggatgctggcgcg
cctgcggcactccgtgggctcgcaaccaacgtggctaactacaatgccttcagcatcgac
acctgcccttcttatacgtcgcagaatgcggtctgtgacgagaagggctacatcaacagc
tttgctcctgagctatcagccgcaggctgggatgcccacttcatcgttgacaccggccgc
aatggcaagcagcccacaggccagattgaatggggcgactggtgcaatgttaagggaact
ggatttggagttcgcccaactaccgacaccggtgacgagttggtcgacgccttcgtttgg
gtcaagcctggtggtgagagcgatggcacctctgaccagagtgctgagcgttacgacgct
cactgtggtgccgctgctgcccttcagccggctcctgaggctggcacctggttccaggcc
tacttcgagcaacttgtggccaacgccaacccgccccttagcagctaa

DBGET integrated database retrieval system