KEGG   Aspergillus nidulans: AN1379.2Help
Entry
AN1379.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K14298  mRNA export factor
Organism
ani  Aspergillus nidulans
Pathway
ani03013  RNA transport
Brite
KEGG Orthology (KO) [BR:ani00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AN1379.2
Messenger RNA biogenesis [BR:ani03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     AN1379.2
Chromosome and associated proteins [BR:ani03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    AN1379.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40 WD40_like FliO
Motif
Other DBs
NCBI-GeneID: 2877155
NCBI-ProteinID: XP_658983
UniProt: A0A1U8QGJ4 G5EAY9
Position
VIII
AA seq 362 aa AA seqDB search
MSGLFGATANTSTAASNTTGDISKDVALNSPPEDSISDLRFSPASEHLAVASWDKKVRIY
EINEQGQSEGKALFEHEAPVLNCCWSPDGTKVVGAGADKAARMLDLAANATAPIQVAAHD
APIRCCHMIPNPAGGTPLLVTGSWDKQVKYWDLRQSTPIASLECQERVYTMDVKDKLLVI
GTADRYINIVDLNNPTKFYKTMQSPLKWQTRVVSCFTDANGFAVGSIEGRCAIQYVEDKD
SSSNFSFKCHRETPPNQRDINNIYSVNAISFHPVHGTFSTAGADGTFHFWDKDAKHRLKG
YPSVGGTISSTAFNRTGNIFAYAVSYDWSKGYSANTPQLPNKVMLHPVAQEEVKPRQNAR
RR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtcggggctctttggcgccacggcgaacacctcaacagctgcaagcaacaccaccggg
gacatctcgaaggacgtcgctctcaactccccacccgaggacagtatctcagatctacgt
ttttctcctgcgagtgaacatctggccgtagcgtcgtgggacaagaaagtccgcatctac
gaaatcaacgagcagggtcagagtgaggggaaagctctttttgagcatgaggcccccgtc
ttgaactgctgctggtcacctgacgggacaaaggtcgtcggagcgggtgcagacaaggcg
gctcgtatgctcgatctcgctgccaatgctactgcgcctattcaggtcgccgctcacgac
gccccgatcagatgttgccacatgatcccaaatccggccggtggcacgcctctcctcgtg
acgggctcctgggacaaacaggtcaaatactgggatttacggcagtcaactcctatcgct
tcgttagagtgtcaggaacgtgtttacacgatggatgtcaaggataaactgctagttatt
gggacggcggaccggtacatcaatatagtcgacctcaataaccccacaaaattctacaaa
accatgcagtcacctctgaaatggcaaactcgggtggttagctgcttcacagacgcaaat
ggttttgccgttggaagtatcgaaggccgctgtgctatacagtacgtcgaagacaaggat
tcgagctcaaacttcagttttaaatgccatcgcgaaacaccgcccaaccagcgtgatatc
aacaacatctactcggtcaacgccatttctttccaccccgttcacggtaccttcagtacg
gccggtgcagatggcacttttcacttctgggataaggatgccaaacatcgtcttaaggga
tatcccagcgtcgggggcacaatttcaagtactgccttcaatcgcacaggcaacatattc
gcctatgccgtgagctacgactggagcaagggttactcggcgaacaccccacagcttccc
aacaaagtcatgcttcatccggttgcgcaggaagaagtgaagccaaggcagaacgctagg
aggcgataa

DBGET integrated database retrieval system