KEGG   Aspergillus nidulans: AN1542.2
Entry
AN1542.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K18651  oligoxyloglucan reducing-end-specific cellobiohydrolase [EC:3.2.1.150]
Organism
ani  Aspergillus nidulans
Brite
KEGG Orthology (KO) [BR:ani00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AN1542.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.150  oligoxyloglucan reducing-end-specific cellobiohydrolase
     AN1542.2
SSDB
Motif
Pfam: Sortilin-Vps10 BNR PSII_BNR
Other DBs
NCBI-GeneID: 2875384
NCBI-ProteinID: XP_659146
UniProt: Q5BD38
Position
VII
AA seq 810 aa
MRAKNGPGSWLALTAIATSLNTLALAAAKTINHSYEFNPVVVSGGGYITGIIAHPTEKNL
LYARTDIGGTYRWNADEDKWIPLNDFISGADENLLGTESVALDPNDPDRLYLAQGRYLNS
ENSAFFVSQDRGATFDVYPAPFKMGANELGRNNGERLAVNPFKTDELWMGTRDAGLMVSE
DGAQTWRNVSGFPQANANGIGIYWVIFDPRSEGTVYVGVGVPGGIYVTRDSGESWEAVPG
QPVEWDEDILVFPAESQPQSTGPQPMKGVLAENGALYVTYADAPGPYGVTYGGVYVYNTT
SSAWTNITPKTNNSFPAPFDNQTFPAGGFCGISVDSKNPERLVVVSLDRDPGPALDSMYL
SHDGGKSWKDVSQLSTPSGSGGYWGHPIEEAAFKDGTAVPWLSFNWGPQWGGYGAPSPVR
GLTKFGWWMTAVVIDPSDSDHVLYGTGATIWATDNLSKVDKNQSPGWYIQAQGIEESVAL
ALASPNGGDSHLLTGLGDINGYRYGDLDVPQPMFDLPVLSNLNALDWAGQKPEIIIRAGP
CGHNYTDGCGLAAYSADGGSSWTKFATCIPGINTSSSNPGVIAIDASGKDIVWSSAMTAY
WPTLQAITPRTNQSGPYVTTDLGQTWVSPTGLNVQTPNISADRVQPRTFYSFTDGTWYLS
RDGGLSYRAYKAKEVGLPAYSGALPIANFNRAGEIWLGLGDHGIYHTRNFGKKWTKITGR
GVTARQLTIGAGARRSSEPTLFIVGKAASHGALSKDGVYRSDDNGKTWVRVNDEKHQYGG
IAMIQGDPRVYGRVYLGTGGRGIIYADIKE
NT seq 2433 nt   +upstreamnt  +downstreamnt
atgagggcgaagaacggacccggcagctggctggcccttacagccattgccacatctttg
aacaccctcgctctcgccgcagcaaagacaattaaccactcctacgaattcaaccccgtc
gtcgtctcgggtggcggctatatcacaggcataatcgcccaccccacggaaaagaacctg
ctctacgcgcgcacagacatcgggggaacatatcggtggaatgcggacgaggacaaatgg
atcccgttaaacgatttcatcagtggcgcggacgagaacttactcgggacggagagtgtt
gccctggaccccaatgatccggatcggctctacctggcgcagggacggtatctaaattca
gagaattccgccttctttgtctcgcaagatagaggggcgacattcgatgtttacccggcg
ccgtttaagatgggtgccaatgagctggggcggaataatggggagagactagctgtgaac
ccgtttaagacggacgagctctggatggggactagggatgcgggcttgatggtgagtgag
gatggggcgcaaacttggagaaatgtgagcgggttccctcaggcgaatgcgaacggaatt
gggatctactgggtgatatttgaccccaggagcgaggggacggtctatgttggcgtcggc
gtgcctggggggatctatgttacgagggactctggagagagttgggaggctgtacctgga
cagccagtagagtgggatgaggatatcctggtctttccagctgaatcgcagccgcagagc
actggaccacagccgatgaaaggtgttttagcagaaaatggcgcattgtatgtgacctat
gccgatgcacctggtccgtatggtgtgacatatggcggagtgtatgtctacaacacgact
tcatctgcgtggaccaatatcacgccgaaaactaacaactcgtttccggcgccattcgac
aaccagactttcccggcgggaggattctgtgggatcagtgtagattcaaaaaatccggaa
aggcttgtggtggtatccctcgatcgcgatcccggtccggctctggacagtatgtacctc
tcgcacgacggtgggaagtcctggaaagatgtgtctcagctttcgacaccatctggctca
ggcgggtactggggccatccgattgaggaagctgcgttcaaagatggtaccgctgttccc
tggctcagcttcaactggggccctcaatggggcggttacggtgccccttctcccgttcgt
gggctgacaaagtttggatggtggatgacggcagttgttatcgacccgagtgactctgac
catgttctttatggcaccggagcgactatctgggcaactgacaacttgtccaaggtcgac
aagaaccagtcccctggctggtacattcaagctcaaggcattgaagaatcggttgcttta
gccttagcaagcccgaacggcggcgattcgcaccttctcaccggtctgggtgatatcaac
ggataccggtatggagatctcgacgttccgcagccaatgttcgacttaccggtgttgtca
aacttgaatgctctcgactgggctggtcagaagccggaaattatcatccgtgccggccct
tgcggacacaactatactgacggctgcggactcgcggcgtattccgcggacggtggcagt
tcgtggaccaagttcgcaacctgcattcctggcataaacacaagctcctcgaatcccggg
gtcattgcgatcgatgcttcaggcaaggatatcgtgtggtcgtcggcaatgacagcgtat
tggccgactctgcaggctatcacccctcgtacgaaccaatccggtccatacgtcaccact
gacttaggacagacttgggtgtctccaactggcttgaatgtgcagactcccaacattagc
gctgacagagtccagccacgaacattttactccttcactgatggaacatggtatctgagc
agggatggcggcctctcctaccgcgcctacaaagctaaagaggtcgggctgccagcatac
tcgggagcgctgccaattgcgaatttcaacagagcaggcgagatatggctgggcctgggg
gatcatggaatctaccatacccgcaattttggcaagaaatggacaaagatcactggacgc
ggagtgacagcaagacagctaacaattggtgccggagcgcgtcgctcatcggaaccaaca
ctcttcattgttggaaaagccgcgagccatggtgctctcagtaaagacggagtataccga
tcagacgataatggtaagacttgggtgcgagtcaatgacgagaagcatcagtacggtgga
attgcaatgatacaaggcgatccgcgcgtgtacggacgtgtctatctgggtaccggcggt
cgcggtattatctatgccgatatcaaggaataa

DBGET integrated database retrieval system