KEGG   Aspergillus nidulans: AN1558.2
Entry
AN1558.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K10356  myosin I
Organism
ani  Aspergillus nidulans
Brite
KEGG Orthology (KO) [BR:ani00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:ani01009]
    AN1558.2
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN1558.2
   03036 Chromosome and associated proteins [BR:ani03036]
    AN1558.2
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ani04812]
    AN1558.2
   04147 Exosome [BR:ani04147]
    AN1558.2
Protein phosphatases and associated proteins [BR:ani01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     AN1558.2
Membrane trafficking [BR:ani04131]
 Endocytosis
  Phagocytosis
   Others
    AN1558.2
 Others
  Actin-binding proteins
   Myosins
    AN1558.2
Chromosome and associated proteins [BR:ani03036]
 Eukaryotic type
  Chromatin remodeling factors
   B-WICH complex
    AN1558.2
Cytoskeleton proteins [BR:ani04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     AN1558.2
Exosome [BR:ani04147]
 Exosomal proteins
  Proteins found in most exosomes
   AN1558.2
SSDB
Motif
Pfam: Myosin_head Myosin_TH1 SH3_1 SH3_2 SH3_9 IQ AAA_16 AAA_22 NACHT
Other DBs
NCBI-GeneID: 2875672
NCBI-ProteinID: XP_659162
UniProt: Q00647
Position
VII
AA seq 1254 aa
MPYSIQGHSRRPAGGEKKSRFGRSKAAADVGDGRQAGGKPQVRKAVFESTKKKEIGVSDL
TLLSKISNEAINDNLKLRFQHDEIYTYIGHVLVSVNPFRDLGIYTDSVLNSYRGKNRLEV
PPHVFAVAESAYYNMKSYKDNQCVIISGESGAGKTEAAKRIMQYIASVSGGSDSSIQQTK
DMVLATNPLLESFGNAKTLRNNNSSRFGKYLELEFNAQGEPVGANITNYLLEKSRVVGQI
TNERNFHIFYQFAKGAPQKYRDSFGVQQPQSYLYTSRSKCFDVPGVDDVAEFQDTLNAMS
VIGMSEAEQDNVFRMLAAILWMGNIQFAEDDSGNAAITDQSVVDFVAYLLEVDAGQVNQA
LTIRMMETSRGGRRGSVYEVPLNTTQALAVRDALAKAIYFNLFDWIVGRVNQSLTAKGAV
ANSIGILDIYGFEIFEKNSFEQLCINYVNEKLQQIFIQLTLKAEQDEYEREQITWTPIKY
FDNKVVCSLIEDKRPPGVFAALNDACATAHADSGAADNTFVGRLNFLGQNPNFENRQGQF
IIKHYAGDVSYAVQGMTDKNKDQLLKDLLNLVQSSSNHFVHTLFPEQVNQDDKRRPPTAS
DKIKASANDLVATLMKAQPSYIRTIKPNDNKAPKEFNESNVLHQIKYLGLQENVRIRRAG
FAYRQTFDKFVERFYLLSPKTSYAGDYTWTGDVETGARQILKDTRIPAEEYQMGITKVFI
KTPETLFALEAMRDRYWHNMAIRIQRAWRNYLRYRTECAIRIQRFWRRMNGGLELLKLRD
QGHTILGGRKERRRMSILGSRRFLGDYVGISNKGGPGEMIRSGAAISTSDDVLFSCRGEV
LVSKFGRSSKPSPRIFVLTNRHVYIVSQNFVNNQLVISSERTIPIGAIKTVSASSYRDDW
FSLVVGGQEPDPLCNCVFKTEFFTHLHNALRGQLNLKIGPEIEYNKKPGKLATVKVVKDG
SQVDSYKSGTIHTGPGEPPNSVSKPTPRGKQVAARPVTKGKLLRPGGPGGGPSKLASRPV
PERRPIPQPTPQTAAAQPTPASRPVPQPVAAVAASHSRTSSTASARAPPPPPPAPPAAAG
PKKAKALYDFSSDNNGMLSISAGQIVEIVSKEGNGWWLCMNLETSAQGWTPEAYLEEQVA
PTPKPAPPPPPPVAPRASPAPVNGSAAVAAAKAKAAPPPPAKRPNMAGRKTAPAPPPAPR
DSAVSMNSQGDSSGASGRGTPSSVSNASLAGGLAEALRARQSAMQGKQDDDDDW
NT seq 3765 nt   +upstreamnt  +downstreamnt
atgccttattccattcagggtcactctcgacgtcctgctggcggggagaagaagagtcgg
ttcggtcgctccaaggccgccgctgatgtgggcgacgggcgacaagccgggggcaagccg
caagtcagaaaagccgttttcgaaagcacaaagaagaaggagattggcgtttcagatctt
acgctgctgagcaagatctccaacgaggcaatcaacgataacttgaagcttcgattccaa
catgacgagatctacacttatattggacatgtgcttgtctctgtcaacccattccgagac
ttgggtatctataccgacagcgtcctcaattcctaccgagggaagaaccggctcgaagtc
cctccacatgttttcgcagttgccgaatcagcctactacaacatgaaatcgtacaaagac
aaccagtgcgtgatcatttctggcgagtcgggtgctggtaaaaccgaggcggcgaagcgg
atcatgcagtacattgccagtgtttccgggggaagcgattcatctattcagcagacgaaa
gacatggttttagcaaccaaccctctactggagtcgttcggtaacgcgaagacgttgcgc
aacaacaattcctcacggtttggaaagtacttggagttggagttcaacgcccaaggcgag
cccgtcggtgctaatatcaccaactatctactggagaagtcgagagtggtgggacaaatt
accaatgagcgcaactttcacatcttttaccagttcgccaagggcgcgccgcagaaatac
agagactcgttcggtgtacagcagcctcagtcctacttatatacgagccggtcgaagtgt
ttcgatgtccctggcgtcgacgatgtggcggagtttcaagatacgctaaatgcgatgtct
gtcattggaatgtcggaagctgagcaggataacgttttccgtatgctagcagcaattctg
tggatgggtaacattcagttcgccgaagatgattccggcaatgctgcgattacagaccaa
tcagtggttgacttcgtcgcatacttattagaggttgacgctggtcaagttaaccaggca
ttgaccattcgcatgatggagactagtcgaggtggtcgccgtggctccgtttatgaggtg
ccactgaataccacccaagctctggccgtacgggatgctctggccaaggcaatttacttc
aacctcttcgactggattgtaggacgcgtcaatcaatccttgactgccaagggagcagtt
gcaaattcaattggcattctcgatatctacggtttcgaaatctttgagaagaactcgttc
gagcagctatgtatcaactatgtcaatgagaagctgcaacagatcttcattcagttgaca
ctcaaggctgaacaagatgagtacgagcgtgagcaaattacgtggacgccgatcaagtac
ttcgataacaaggttgtgtgttcgttgattgaagataagcggccccctggtgtcttcgct
gccctgaatgatgcttgcgcgacggcgcacgctgactcaggagccgcggacaacactttc
gttggacggctgaacttccttggacagaacccgaatttcgagaaccgtcagggccagttc
attatcaaacactacgccggcgatgttagctacgctgtccagggaatgacagacaagaac
aaggaccagctgctcaaggatttgctgaatcttgttcaatcgagtagcaaccatttcgtt
cacactcttttcccggaacaggtcaaccaagatgacaagcgccgaccacctacggcaagt
gacaagatcaaggcttctgccaatgatctagtagcaacgctcatgaaagcccaaccgtca
tatattcgaaccattaagcctaatgataataaagcgccgaaagagtttaacgagagcaat
gttcttcaccagatcaaataccttggtcttcaggagaacgtccgcattcgtcgggctggt
ttcgcgtaccgccagactttcgacaagttcgttgaacgtttctatctgctgtctccgaag
acgtcctatgccggtgattacacctggacgggcgacgtggaaacaggagcgcgccagatt
ctgaaggacactcggattccggccgaggagtaccaaatgggtatcacaaaggtatttatc
aaaacccccgaaacgctctttgccttggaggctatgcgcgaccgctactggcacaacatg
gctattcgtattcagcgcgcatggcgaaactatttacggtaccgtaccgagtgtgccatc
cgtatccagcgcttctggcgccgaatgaatggaggacttgagttgctcaaattacgtgac
caagggcatacgatcttgggtggccgaaaagagcgtaggagaatgagcattcttggttct
cgacggttccttggtgattacgttggtatcagcaacaaaggtggtcctggagagatgatt
cgcagcggcgcggctattagtacctctgatgatgtcctattctcctgccgcggagaggtt
cttgtttcgaaattcggtcgctcaagcaagccttcgccacgcatcttcgtcttgaccaat
cgacatgtttacattgtgtcccaaaacttcgtcaataaccaacttgtcatttcatcggag
agaactatccctatcggagccatcaagaccgtcagtgcttctagctaccgagacgattgg
ttttcgttagtggtgggcggacaagagccagatccgctctgcaattgcgttttcaagact
gagttttttactcatctgcacaatgctcttcgaggtcagttgaatttgaagatcggccca
gagattgaatacaacaagaaaccgggcaaactagccactgtcaaggtagtcaaggacgga
tcgcaggttgacagctacaagagtggaacgatccacacaggtccaggcgaacctccaaac
tctgtctccaagcctaccccacgagggaaacaagtagctgcccggcccgtcacgaaagga
aaacttcttcgtcctggcggtccaggcggtggcccgtccaaactggcttccagacctgta
ccagagcgtcggcctataccacagcccacgcctcaaacagccgcggcgcaaccgacacca
gcgtccagacccgttcctcaaccagtggcagccgttgcagcatcccattcacgtacttca
tctactgcctccgcaagggcaccacccccgcctcctcccgcaccacctgcagctgcagga
ccgaagaaagcaaaggccctgtacgacttcagcagcgacaacaatggcatgttatcgatt
agcgcaggacaaattgtggaaatcgtttccaaagaaggaaacggctggtggctgtgcatg
aacctcgaaacctcagcgcaaggctggacacccgaagcatatctcgaggagcaagttgca
cccacgcctaaacccgcacctccacctccacctccagttgctccccgagcaagcccagca
ccagtgaatggatccgccgcagttgctgcagcgaaagccaaagcggcgcctccgcccccc
gctaaaaggcccaacatggcaggccgtaaaacagcacctgcgcctccacctgcaccccgc
gatagtgctgtcagcatgaattcgcaaggagattcttctggtgcaagtggtcgcggcacc
ccaagcagcgtttccaatgctagtcttgctggtggtcttgccgaagccctgagggcacgg
cagagcgcgatgcaggggaagcaggatgacgacgacgactggtga

DBGET integrated database retrieval system