KEGG   Aspergillus nidulans: AN1818.2Help
Entry
AN1818.2          CDS       T01016                                 

Definition
(RefSeq) XYNC_EMENI Endo-1,4-beta-xylanase precursor (34 kDa xylanase) (1,4-beta-D-xylan xylanohydrolase) (X34)
  KO
K01181  endo-1,4-beta-xylanase [EC:3.2.1.8]
Organism
ani  Aspergillus nidulans
Brite
KEGG Orthology (KO) [BR:ani00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AN1818.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.8  endo-1,4-beta-xylanase
     AN1818.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_10 RES
Motif
Other DBs
NCBI-GeneID: 2874673
NCBI-ProteinID: XP_659422
UniProt: Q00177
Structure
PDB: 

Position
VII
AA seq 309 aa AA seqDB search
MVHLKTLAGSAVFASLATAAVLPRQSASLNDLFVAAGKSYFGTCSDQALLQNSQNEAIVA
SQFGVITPENSMKWDALEPSQGNFGWSGADYLVDYATQHNKKVRGHTLVWHSQLPSWVSS
IGDANTLRSVMTNHINEVVGRYKGKIMHWDVVNEIFNEDGTFRNSVFYNLLGEDFVRIAF
ETARAADPDAKLYINDYNLDSASYAKTQAMASYVKKWLAEGVPIDGIALSSLANTGVSEV
AITELDIAGAASSDYLNLLNACLNEQKCVGITVWGVSDKDSWRASDSPLLFDGNYQPKDA
YNAIVNALS
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggtccatcttaaaaccctcgccggcagcgctgtctttgcctcgctggccaccgcggcc
gtcctcccccgtcaaagcgccagcctaaatgatctttttgtcgcggccggcaaatcctac
tttggcacttgctccgaccaggcgctgctgcagaactcgcagaacgaggccattgtggcg
tcgcagttcggagtgatcaccccggagaacagcatgaaatgggacgcgcttgaaccgtct
caggggaactttggctggtctggagccgactaccttgtcgactacgcgacgcagcataac
aagaaggttcgcggacatacgctcgtctggcactcccagctcccctcttgggtctcgtcc
atcggcgatgcgaacacactcagatccgtcatgacgaaccacatcaatgaggtcgtcggc
cggtacaagggcaagatcatgcactgggacgtcgtcaacgagatcttcaacgaagatggc
accttccgcaacagcgtcttctacaacctcctgggcgaggactttgtgcggattgcgttc
gagactgcgcgcgccgcggaccctgatgcgaagctgtacatcaacgactacaacctggac
tctgcgagctacgccaagacgcaggcgatggcgagctacgtgaagaagtggttggcggag
ggcgtgcctatcgatggaatcgcgctgtcctctctcgctaacacgggcgtctccgaggtt
gccatcaccgagcttgatattgcgggcgcagcctcgtccgactacctgaacttgctcaac
gcctgcctcaacgagcagaaatgcgtgggcatcaccgtctggggagtgtccgacaaggac
tcgtggcgcgcgtccgacagccccttgctgtttgacggcaactaccagcccaaggatgcc
tataacgcaatcgtcaacgctctgtcttag

DBGET integrated database retrieval system