KEGG   Aspergillus nidulans: AN2251.2
Entry
AN2251.2          CDS       T01016                                 

Name
(RefSeq) hypothetical protein
  KO
K08994  ion channel-forming bestrophin family protein
Organism
ani  Aspergillus nidulans
Brite
KEGG Orthology (KO) [BR:ani00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ani02000]
    AN2251.2
Transporters [BR:ani02000]
 Other transporters
  Pores ion channels [TC:1]
   AN2251.2
SSDB
Motif
Pfam: Bestrophin
Other DBs
NCBI-GeneID: 2874617
NCBI-ProteinID: XP_659855
UniProt: Q5BB29 A0A1U8QG68
Position
VII
AA seq 499 aa
MDGGTAHSAPPADAGHAAAHTDGPAPVQAETRHANNAQGQHSGPPSEKSSSPGRMTPRPT
FLENLADSRDSQFMLNRRDSDDLDRYFHGPRDLDKHSKWPIMMRMHGSIMPKMILPITFV
AGWSTCITLISRFVYRLSVDNILLTVLGFVVGLSLSFRSSTAYERWADGRKYWSLLVQTS
RNLSRTIWINTLEREGELGKEDLLRKLTAINLILAFAVALKHKLRFEPDVGYEDLAGLVG
YLDTFAKEAHDRQVIQPRKRTIWKVTGEYLGVSFAESNPRKLIKRSKKPLGHLPLEILNH
LSAYIDSVIRNETLNISLHQSQAIACLAQLNEVVTGTERVLDTPLPVAYSIAIAQIAWIY
VLVLPFQLYDSLGWVTIPGSIVAAYIILGLATIGSEIENPFGHDVNDLPLDTYCRQIALE
LDIVTAVPPPSVDEFTSREDNYVLYPLSTSGQPEWKERSVEDIRAALRAKVVANTSPTAS
KTSTVLEEVNTKLNKQSSV
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggacggaggcaccgcgcactctgcacctcccgctgacgcaggccatgctgctgctcat
acggatggtcctgctccagtacaggcagagactcgccatgccaacaacgctcaaggacaa
cacagcggccctccaagtgagaagagctccagccctggacgaatgacaccacggcccacc
ttcttggagaaccttgcagactctcgtgattcccagttcatgctcaaccggcgcgactct
gatgatctggatcggtactttcacggcccgcgagacctggacaaacactcgaaatggccc
atcatgatgcggatgcacggcagcatcatgccgaagatgatcctccccatcaccttcgtc
gccggctggtctacttgtataaccctgatttcgcgctttgtttatagactttctgttgat
aatatcctcctcaccgttctcggtttcgtcgttggtttgtcactttcatttcgaagctct
actgcctacgaaagatgggcggatggccggaagtactggtcgttgcttgtgcagacgtct
cgtaacttgtcccgtaccatttggatcaacacactcgagcgggaaggtgagctaggaaaa
gaggacctattgaggaagctcaccgcgatcaaccttatcttggcctttgcagtggctctg
aagcataagctgcggttcgaaccggatgtcggatacgaggatctagctggcctagttggg
tatctcgacacctttgctaaggaagctcacgatcgccaagtcattcagccaaggaagagg
acgatctggaaagttactggcgagtacttgggcgtttctttcgcagagtcgaaccctcgg
aagctcatcaaacgctccaaaaagcccttgggacacctacccctggagattctgaaccac
ctttcggcctatatcgactcagtcatccgaaacgaaacactcaacatcagtctccaccag
tcccaggctattgcctgcctcgcccaactaaacgaagtcgtcaccggcactgaacgcgtc
ctcgacaccccgctcccagtcgcctacagcatcgcaattgcgcaaatcgcttggatttac
gttcttgtcctccccttccagctctacgactctcttggctgggtcacgatccctggctcc
attgtcgctgcgtacattattcttggcctagcaaccattggcagcgaaatcgagaacccc
ttcggccacgacgtaaatgatctgcctctcgacacatattgcagacagatcgcgcttgaa
ctggatattgtcaccgctgtaccgccgccaagtgttgacgaattcacctcccgcgaggac
aactatgtcctatacccacttagcacatcgggccagcccgaatggaaggagcgcagcgtg
gaggacatccgtgctgcgctgcgcgctaaagtcgttgctaacacgtcgccgacagcgtcc
aagacgtccaccgtacttgaggaggtgaatacaaagcttaacaagcagtcatcagtatag

DBGET integrated database retrieval system