KEGG   Aspergillus nidulans: AN2366.2
Entry
AN2366.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
ani  Aspergillus nidulans
Brite
KEGG Orthology (KO) [BR:ani00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ani01002]
    AN2366.2
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ani04147]
    AN2366.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     AN2366.2
Peptidases and inhibitors [BR:ani01002]
 Serine peptidases
  Family S1: chymotrypsin family
   AN2366.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AN2366.2
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 2875466
NCBI-ProteinID: XP_659970
UniProt: A0A1U8QWP9 Q5BAR4
Position
VII
AA seq 249 aa
MKTAVKTTALLSLLSTAMADKAIVGGDDAEITEYPYQIALLSGGSLICGGSIISSKYVVT
AGHCTDGASASSLSIRAGSTYHDKGGTVVDVEAITVHPEYNANTVDNDISILELAEELQF
GDGIKAIDLPSSSSLPSEGTIGTATGWGALTEGGNVSPNLQYVEVPVVSKSQCSSDYSGF
NEITASMFCAGEEEGGKDGCQGDSGGPFAADGVLIGITSWGNGCARAGYPGVYSSPAYFR
DFIQQVTGL
NT seq 750 nt   +upstreamnt  +downstreamnt
atgaagaccgccgtcaaaaccaccgcccttctctcccttctctcgaccgcgatggccgac
aaggccatcgttggcggcgacgacgccgagatcaccgaatacccttaccagattgcgctc
ctctctggcggctccctcatctgcggcggctctatcatctcttccaagtacgtcgtgacg
gccggccactgcactgacggcgcgtccgctagctcgctctccatccgcgcgggctccacc
taccatgataagggcggcaccgtcgtcgacgtggaggcgatcaccgtccaccctgaatac
aacgccaacaccgtcgacaacgacatctccatcctcgagctggcagaagagctccagttc
ggcgacggcatcaaggcgatcgatctgccttcctcttcttcgcttccttctgagggcacc
atcggaaccgcgacgggctggggtgcgctgaccgagggcggcaacgtcagccctaacttg
cagtatgtggaggttcccgttgtcagcaagagccagtgctcgagtgactactccggcttc
aacgagatcaccgcgtcgatgttctgcgccggcgaggaggagggcggcaaggatggctgc
cagggcgattccggcggtcctttcgctgcggacggtgtcctgatcggtatcacctcatgg
ggcaatgggtgtgcgcgtgccggataccccggtgtttactcgagcccggcttacttcagg
gacttcatccagcaggttactggtctgtaa

DBGET integrated database retrieval system