KEGG   Aspergillus nidulans: AN2777.2
Entry
AN2777.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
Organism
ani  Aspergillus nidulans
SSDB
Motif
Pfam: FAA_hydrolase Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Ser_hydrolase Abhydrolase_4 Abhydrolase_8 DUF915
Other DBs
NCBI-GeneID: 2874317
NCBI-ProteinID: XP_660381
UniProt: A0A1U8QQ83 Q5B9K3
Position
VI
AA seq 587 aa
MVFNYCAYADPATGEDRIGHLDHQSLQIQPLSFTSGTRITNLYQVIEAGQASIVSARAEP
LPLSSVKLLPTISGRDILAVGKNYVEHAKEFNSSGFDSSDKVDQPTAPVIFTKRATSIIA
HGEDVLLHPGFTETPDYEGEIGVIIGKAGHKIPEDQAMDYVWGYTIINDFTARERQRDHK
QFYIGKSPDTYCPIGPVAVPKEQLPEKENIRLQTFVNGEKRQDATLDQLIFSIPNLVSTL
SQGQTIQPGDTIATGTPYGVGFGFRPMKFLKAGDEVKVSVTGLGSLVNRMAALDAPNPTI
ERVQASTSIHTANQKARGNNGLVKVGSKQLFYQFQGQKDGTPVIFIHGLGGSSSYFTPLL
DKLSATHALHLTDLEGHGLSPTSALSSLTISSFAGDIRDVYILAAGSNPKPATVIAHSMG
CLIALKLALENLNLVSNLVLLGPPPSPLPEAGSNGSFARAETVRAQGMAAVADAVVNAGL
SSKTKSSNPLAVTATKLSLLGQDPEGYAKACMALARSAEETLDVEEVAAKTLILTGTADA
VSPPALCEKYGQRIKDSTVVVLEDVAHWHLFEHVEGVRGAIYQFLGV
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggtgttcaattactgcgcctacgctgatcccgcaaccggggaggaccgcatcggccac
cttgatcaccaatccctccaaatccagcctttatccttcacatcaggaacaaggatcacc
aacctctaccaagtcattgaagccggccaggccagtatcgtcagtgcccgcgctgagccc
ctccccttgtccagcgttaaactcctccccaccatttccggccgcgatatccttgctgtc
ggcaagaactacgtcgaacacgcaaaagaattcaactcctctggctttgattcttcagac
aaagtcgaccagcctactgcaccagttatcttcacgaagcgggcgacttcgatcattgcg
catggcgaagatgttctcctccaccccggcttcactgaaacccctgactatgagggcgaa
ataggggttatcatcggcaaggcagggcacaagatcccagaagaccaggcgatggattat
gtctggggatacacaatcatcaacgatttcacagcacgcgagagacagcgcgatcataag
cagttctacatcggcaagtcccctgatacgtactgcccgatcgggcccgttgccgtgccg
aaggaacagctccctgaaaaggagaatattcgtctgcagacatttgtaaatggcgagaag
aggcaagatgccacgctggaccagttgattttctccatcccgaatctcgtctcgaccctg
tcgcagggtcagacgattcagcctggagacaccattgccacgggcacaccttacggtgtg
ggttttggcttccggcccatgaaattcctcaaggctggtgacgaggtcaaggtctccgtc
actggccttggatcgttggtcaacagaatggcagcgcttgacgcgcccaatccgaccatt
gagcgtgtgcaagcgtccacgtccattcatacggccaaccagaaagcaagaggaaacaac
ggcctggtgaaagtaggctcaaaacagctcttctaccaatttcagggtcagaaggacggc
actcctgttattttcatccacggcctcggcggctcatcctcctactttacgccgctgctt
gataaactctcagctacgcacgccctccaccttacagacctcgaaggtcacggcctctcg
cctacgtccgcactcagcagtcttacaatctcatcgtttgccggcgacatccgcgatgta
tacattcttgccgcaggatcaaacccaaaaccagcaaccgtgatcgctcattcaatgggc
tgcctcatcgcgctcaaacttgctctcgaaaacctcaacctcgtcagcaacctcgttctc
ctcggcccgcctccctctcctctccctgaagccggaagcaacggaagcttcgctcgcgct
gaaacagtccgagcccaaggcatggccgccgttgcggatgcagtcgtaaatgcaggtctc
tcctcaaaaacaaaatcttccaacccgctcgctgtcacagccacaaagctttctttgttg
ggccaagacccagagggttatgccaaggcgtgtatggcgcttgcccggtcggccgaggag
acgctggatgttgaggaggttgccgctaagacactgatcctgacagggacggccgatgct
gttagtccgccggcgctgtgtgagaagtatgggcagcggatcaaggactcaacagtggtg
gtcttggaggatgtcgcacattggcaccttttcgaacatgttgagggtgttcgaggcgcc
atataccaatttttgggcgtttga

DBGET integrated database retrieval system