KEGG   Aspergillus nidulans: AN3547.2
Entry
AN3547.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
Organism
ani  Aspergillus nidulans
SSDB
Motif
Pfam: TPR_10 TPR_12 TPR_7 TPR_1 TPR_MalT TPR_2 TPR_8 TPR_14 TPR_17 TPR_16 DUF2225 TPR_19 RNPP_C TPR_21 NB-ARC PNP_UDP_1 TPR_11 AAA_16 SNAP ATPase_2 NACHT AAA_22 DUF3106 PS-DH HAD_SAK_2
Other DBs
NCBI-GeneID: 2872969
NCBI-ProteinID: XP_661151
UniProt: Q5B7D3 A0A1U8QY66
Position
II
AA seq 1288 aa
MTKRARPQGQAVPEGSMPRHEDHVTRLAVRLKMRPSSRDEFAIAIICALTLEAEAVEDLF
DEIYDRLGEHYRKEPGDDNAYVNGRIGNHNVVVCYMPGIGKGSAASVASSLKISYKRIEV
ALVVGICGGAPYPLSGGEVFLGDVIISDSVVQYDFGRQYPGGFKKKLGVRDTLGRPNRAI
RSILASLQARRSRKDLQDKLLQHLQALQESLSDWHYPTIDDILFEASYQHKHYGLTSPAC
PCLDSMSEDICKTAVESPCTSLGCDMDRSEGVVGFEMEGAGVWDNISCIIIKGVCDYADS
HKNKAWQAYAAATGAAAAKSFLEYWEPTAREDLSAVPVIEEFIGREEELNCLWDYLQPAS
SQTRRVAVLHGLGGIGKTQLAIHFARKHKNEFTAIFWLNSKDQSALVSSLSSCLSQIQGP
PIEDQAVNKEEAVQRANQVLQWLARPGNTRWLIIFDNVDQYSPIQGHGHCGFDVYEFFPK
ADHGSIMITSRLQGLTELGKSFPVQKLIYKDATQLLLQSSGFSAKDITQMGAEQDLMNLA
SLLDGLSLAIVIAGAFMCQTGTTFKEYLELYRTSWFDLQSQSAPKRQYQQGNIVQTWNIT
YKEIQKHDSTAAKLLLLLAFFDNQDIWYELIRNGLDYSNPPQWFETAVSSKLVFKAKLKA
LVKFSLVEIKQQEGSYTLHPVVQDWCYHIAALDGLTNQLQELAFISVGNMVPSYDTRDYA
RLEQRLLPHANNLIQRNIGHWLDIQPEDRINIFGAFHGLGNLYSDQRKLKEAEEMYQQAL
AGKEKALGPDHTSTLDTVNNLGNLYSDQGKLKEAEKMYQRALAGKEKALGPDHTSTLDTV
NNLGILYSDQGKLKEAEEMYQRALAGYEKALGPDHTSTLVTVNNLGNLYSDQGKLKEAEK
MYQQALKGYEKALGPDHTSTLDTVNNLGSLYKNQGKLKEAEEMYQQALAGKEKALGPDHT
STLDTVNNLGILYKNQGKLKEAEEMYQRALAGKEKALGPDHTSTLMTVNNLGSLYSDQGK
LKEAEKMYQQALAGYEKALGPDHTSTLITVNNLGNLYSDQGKLKEAEKMYQQALAGYEKA
LGPDHTSTLVTVNNLGNLYSDQGKLKEAEKMYQQALAGYEKAVGPDHTSTLDTVNNLGIL
YSDQGKLKEAEKMYQQALAGYEKALSPDHTSTLMTVNNLGSLYKNQGKLKEAEEMYQQAL
AGKEKALGPDHTSTLMTVNNLGILYSDQGKLKEAEEMFQRALAGYGKALGPNHSKTCVVA
NNLVSLASLHAEQDSPRHIHVSPDPHPQ
NT seq 3867 nt   +upstreamnt  +downstreamnt
atgactaagcgagctcgaccccaggggcaggcggtaccagagggcagtatgccccgacac
gaggatcatgtcacgagactggccgtgaggctgaagatgcgcccatccagtcgggacgaa
tttgcgatcgcgatcatctgcgcgctgacactcgaagcagaggcagttgaagaccttttt
gatgaaatttacgacaggttgggcgaacactacaggaaagaaccgggcgatgataatgca
tatgttaatgggaggattggaaatcataacgtggtggtgtgctatatgcctggcataggc
aaagggagtgcagccagtgtggcatcgagcttgaaaatcagctacaaaaggattgaagtg
gcgctggttgtcggtatttgtggaggtgcaccatacccattatctggtggagaggtcttt
ctaggggatgtcataatcagtgactctgtggtacagtacgacttcggcaggcagtatcct
ggtggctttaaaaagaaactgggtgtcagggacacgcttggacgaccaaaccgagctatc
cgttcaatactggcaagtctccaggcaagacgatcgcgcaaagaccttcaagataagctg
ctacaacatctacaagcacttcaggaatcactatctgattggcattacccaactattgat
gacatcctcttcgaagcttcataccaacataagcactatggcctgacttcacctgcgtgt
ccttgccttgatagcatgtctgaagatatctgcaagacagctgtcgaatcaccttgtact
tctctaggctgtgatatggaccggtcagaaggtgttgttggtttcgagatggagggtgca
ggggtgtgggacaacatatcatgcattattataaaaggggtgtgtgactatgcagatagc
cacaagaataaagcatggcaagcatatgcagcggcgactggagctgcggccgccaaatct
ttcttggagtactgggagcccactgctcgagaagatctttcagcggttcctgtgattgag
gagttcattggacgagaagaagaactaaactgtctatgggattatctacaaccagcaagt
tcacagacacgaagggtggctgtcctccatggtctgggtgggattggcaaaacacaacta
gcaattcactttgcacgaaaacacaagaatgaatttacagccatattctggctgaacagc
aaggatcaatctgccttggtttcatctttgagttcttgcctctctcagatacaaggaccg
cctatagaggatcaggcagtcaacaaagaggaagcagtacaaagggcaaaccaagtacta
cagtggctggcaaggccaggcaacactagatggctcattatctttgacaacgtcgaccag
tattctccaatccaaggccatggtcactgtggatttgatgtctacgaattctttccaaag
gctgatcatggatctatcatgatcacttcccggctccaagggctcactgaacttgggaag
tcatttccagttcagaaacttatatacaaagatgctacgcagctattgttgcaaagcagc
ggcttttcagctaaagacattacacagatgggagctgaacaagaccttatgaatcttgcc
agcctgctggatgggctctcgctggcaattgtcatagctggggctttcatgtgtcaaaca
ggaacaacttttaaagagtatctggagctctaccggacttcctggtttgacttgcagtct
cagtcggcacccaaacgccaataccagcaaggcaacattgtacaaacatggaatatcacc
tataaagagatccagaaacatgattccactgccgcgaaactcttgctcctacttgcattt
tttgataaccaggatatctggtatgaactaattcgaaacggtttggactactcaaacccg
ccacaatggtttgagacagcagtgtcaagcaagctggtctttaaagcaaagctaaaagca
ctagttaagttctcgcttgttgaaataaagcagcaggagggaagctatactctgcatccc
gtggtacaggactggtgttatcatattgctgccttggatggactcacaaatcaactacag
gagctggcgttcatctcggtaggaaatatggtccccagttatgacaccagagattatgca
aggcttgagcagcgattacttcctcacgcaaataatctaattcaaaggaatataggccat
tggcttgatatacagcctgaagacagaatcaacatttttggcgcctttcatggcttaggt
aatctctactctgatcagcgcaagctgaaagaggcagaggaaatgtatcagcaagcactg
gcaggcaaggagaaagcactgggtcctgaccacacgtccacccttgatacagtcaacaat
cttgggaatctctactctgatcagggcaagctgaaagaggcagagaagatgtatcagcga
gcattggcaggcaaggagaaggcactgggtcctgaccacacatccacccttgatacagtc
aacaatcttgggattctctactctgatcagggcaagctgaaagaggcagaggaaatgtat
cagcgagcactggcaggctatgagaaggcactgggtcctgaccacacgtccacccttgtg
acagtcaacaatcttgggaatctctactctgatcagggcaagctgaaagaggcagagaag
atgtatcagcaagcactaaaaggctatgagaaagcactgggtcctgaccacacatccacc
cttgatacagtcaacaatcttgggagtctctacaagaatcagggaaagctgaaagaggca
gaggaaatgtatcagcaagcactggcaggcaaggagaaggcactgggtcctgaccacaca
tccacccttgatacagtcaacaatcttgggattctatacaagaaccagggcaagctgaaa
gaggcagaggaaatgtatcagcgagcactggcaggcaaggagaaggcactgggtcctgac
cacacgtccacccttatgacagtcaacaatcttgggagtctctactctgatcagggcaag
ctgaaagaggcagagaagatgtatcagcaagcactggcaggctatgagaaagcactgggt
cctgaccacacgtccacccttataacagtcaacaatcttgggaatctctactctgatcag
ggcaagctgaaagaggcagagaagatgtatcagcaagcactggcaggctatgagaaagca
ctgggtcctgaccacacgtccacccttgtgacagtcaacaatcttgggaatctctactct
gatcagggcaagctgaaagaggcagagaagatgtatcagcaagcactggcaggctatgag
aaagcagtgggtcctgaccacacatccacccttgatacagtcaacaatcttgggattctc
tactctgatcagggcaagctgaaagaggcagagaagatgtatcagcaagcactggcaggc
tatgagaaagcactgagtcctgaccacacgtccacccttatgacagtcaacaatcttggg
agtctctacaagaatcagggcaagctgaaagaggcagaggagatgtatcagcaagcactg
gcaggcaaggagaaagcactgggtcctgaccacacgtccacccttatgacagtcaacaat
cttgggattctctactctgatcagggcaagctgaaagaggcagaggagatgtttcagcga
gcactggcaggctatgggaaggcactgggtcccaatcattcaaaaacttgtgtagtcgca
aacaatctagtgtctcttgctagccttcacgctgagcaagacagccctcgccacatccat
gtttcccccgacccccacccgcagtag

DBGET integrated database retrieval system