KEGG   Aspergillus nidulans: AN3837.2Help
Entry
AN3837.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ani  Aspergillus nidulans
Pathway
ani00052  Galactose metabolism
ani00500  Starch and sucrose metabolism
ani01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    AN3837.2
   00500 Starch and sucrose metabolism
    AN3837.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AN3837.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF4975
Motif
Other DBs
NCBI-GeneID: 2873260
NCBI-ProteinID: XP_661441
UniProt: Q5B6J3
Position
II
AA seq 633 aa AA seqDB search
MPGAMSTPSKPTAPAFTRWRPKFHLLAPSNWLNDPCGPGYDPCTGRYHLAYQWNPKDNEW
GDICWGRATSCDLVSWEIDPEPCLAPSAPYDSKGIFTGCFQSTNLQGQQDGTLTYFYTSV
KSLPIHYTLPYSNGCETLSIALSRDAGRTWERHAQNPILPGPPAGLQVYGWRDPFVCSWP
SAPESVREAARQVVGEGDVMYGFISGGLVNKTPTVFVYAITRNTLTEWKYVGILLDVGLN
YTLSRWSGDLGVNWEVSNLVTLTNKEGTSRDFLIMGVEGCIPSPDPNRPAARDRRIQRSQ
LWTCIKQNETRGQTQTALMQTSFGGIFDSGLFYAANSFFDPVTQRQVVFGWITEEDLPDT
TRKEQGWSGLVSLPRTLTLQTIHCVKRARSTTSLGDITSVEAVPDEQGTYTVHTLGVELD
PRVEELRKGARVLTREALDLSFNVDEAGTVMAATTSTQSSGCFVPLDTTRWEVDAEIAVG
RKCSRVGMVIFHDEDYTAKTTLFWDPVHETFQVERPRPSNINPDINHAPEVTPHTLFTYT
NPATTTNDNTASEIETEEPLRIHALFDSSVLEVFVNGRTAITTRIYHSGGRTKTDGPKCV
GVQFFADAENAGCDADAHAHSGGGAGEIDMLMA
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgcccggtgccatgtctacaccatccaaaccgaccgcgccggcattcacaagatggagg
cctaagttccatctcctcgcacccagtaactggctcaacgacccctgcggccctggctac
gatccctgcacaggaagataccaccttgcgtaccaatggaatcctaaggataacgaatgg
ggcgacatctgctggggtcgcgcaacgtcatgcgatctagtctcatgggaaatcgaccca
gaaccctgtcttgcgccgtctgcaccctacgacagcaaagggatcttcacaggatgcttc
cagtcgaccaacctccagggccagcaagacggcacacttacttacttctacacttctgta
aaaagccttccaattcactatacccttccttactcgaacggatgcgagaccctgagtatc
gcgctgtcccgagatgcaggacgcacgtgggaaagacacgcgcagaaccccatactccct
ggcccaccggccggtttacaggtctacggctggagagacccgtttgtatgttcctggcca
tctgcaccggagagtgtccgtgaggcggcgcggcaagtggtaggggaaggggacgtcatg
tacgggttcatctcgggtggtctagtcaataaaacgccgacggtctttgtgtacgcgatt
acacgaaacactctcacagagtggaaatacgtcgggatcctcctggacgtcgggctcaat
tataccctgtcccgctggtccggcgatctcggtgtgaactgggaagtctcaaatctcgtc
acgttgacaaacaaggaaggcacttcacgcgattttctaatcatgggcgtggagggatgc
attccgagcccagacccaaatcgcccagccgcccgagatcgccgcatccaacgctcccag
ctctggacttgcatcaagcaaaacgaaacccggggccaaacacagactgctttgatgcaa
acctccttcggtggcattttcgatagtggacttttctatgcggctaattccttcttcgac
cccgtcacccagcgacaggtcgtgttcggttggatcacagaggaagatctgcccgacacg
acgcggaaagagcaaggatggagcgggctggtctcgttgccgcgcacgcttacacttcag
acgattcactgcgtaaagcgcgcgcgctcaacgacttcattaggcgacattacctccgtc
gaagccgtaccggatgagcaggggacgtacaccgttcatacgctgggcgtggagcttgat
ccacgtgttgaggagttgcggaaaggtgcgagggtacttacgcgtgaggccttggatttg
tcctttaatgtcgacgaggcgggtacggttatggcagcgaccacaagtacacagagcagc
ggctgctttgtccccttggacacgacgaggtgggaggttgatgcggagattgcggttgga
aggaaatgtagccgggttggaatggttattttccacgacgaagattacactgccaaaacg
actcttttctgggaccctgtgcatgagacattccaggttgaacgtccacgtccatctaat
atcaaccccgacatcaaccacgccccagaagtcaccccgcatacactattcacatacact
aacccagccacgaccaccaacgacaacaccgcgtcagaaatagaaacagaagaacccctg
cgcatccatgctctcttcgacagtagtgtgcttgaggtcttcgttaacggccgcacagcg
ataaccactcggatttatcattccgggggccgaacaaaaactgatggtcccaaatgtgtt
ggggttcaatttttcgcagatgctgagaatgcaggctgtgatgctgatgctcatgctcat
agtgggggtggagctggagaaatagatatgcttatggcgtag

DBGET integrated database retrieval system