KEGG   Aspergillus nidulans: AN4006.2
Entry
AN4006.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
Organism
ani  Aspergillus nidulans
SSDB
Motif
Pfam: GMC_oxred_N GMC_oxred_C DAO FAD_binding_2 NAD_binding_8 Thi4 Pyr_redox_2 Lycopene_cycl NAD_binding_9 Pyr_redox_3 HI0933_like TrkA_N
Other DBs
NCBI-GeneID: 2873428
NCBI-ProteinID: XP_661610
UniProt: Q5B624 A0A1U8QLI6
Position
II
AA seq 610 aa
MHLTWATGIAGLAIWLGRIPPGQTLATESRLLATYDYVIVGAGVSGLTVANRLSENKKLS
VLIIEAGGFDEDEDFILVPGLAGNAIGTKYDWNLTYAVNPDLGNRTVSIPQGKAVGGSSL
LNRMVFDRGSKADYDRWEALGNPGWGWRDLFPFFKKSENFTPPSEDVIDEWNATYDPAVH
GTTGNVQSSYAPWIWPSTKQFISAITSLGVHVPRDGASGDALGGFFVPHSQDAISVTRSD
ARRAYWDAVSKRPNVHLLTGQRVTRMISKRTSRRVQITGVEFAAHRSGARTIVNARKEVL
LAAGAIHTPQLLQLSGIGDRATLNRHNISTVADVPGVGRNLQDHLHVPVVFSFDFPLTAT
NLTTNSTFAAESWALYRTHKTGPYADATGDFLAFFPTVNFTSQADVLQGIAADQNPQAYL
DKDTPPSIVDGYAVQHKLLTSGLAATDEAQLEIIWADGTFVLGLQHPFSRGSVRLASSDP
FAQPLADPAYLRNPVDVRILIEAIKYARSLTTTLSLAAFNPVELVPGGSITSDEDLEAYV
RGAVDSLFHPSGTCAVGKFELGGVVDVDFKVHGVKGLRVVDASVLPMLPATHIQSSVYAV
AEKAAKAILS
NT seq 1833 nt   +upstreamnt  +downstreamnt
atgcatctcacatgggccaccggaatcgccggcctggctatatggctcggccgcatccca
cctggtcagaccctggccacggagtccaggttgctggccacctacgactatgtgattgtc
ggcgcaggagtctcaggacttacggtagcgaatcgcctgtcagagaacaaaaaactaagt
gttctcatcattgaagcaggcggattcgacgaagacgaagactttatccttgttcctggc
cttgcggggaacgcaatcggcacaaagtatgactggaacttgacatacgcggtaaacccg
gacctgggaaatcgtactgtttctatcccccaaggaaaggcagtcggaggctcgagtctg
ttgaaccgcatggtctttgatcgcggatccaaggctgactatgaccgctgggaggcactg
gggaatcctggttggggttggagggacctctttccattcttcaaaaagagtgagaacttc
acgcctccaagcgaggacgtgattgatgagtggaatgccacatatgacccagcagtccac
ggcacgactggcaacgtccagtccagctacgctccgtggatttggccttctacaaaacaa
ttcatcagcgcgattacgagccttggggtccatgttccccgtgatggtgcgagtggcgac
gccctcggtggatttttcgtgccccatagtcaggatgcgatttctgtgactcggagtgac
gcccgcagggcctactgggatgcggtgtcgaagagacccaatgttcatcttcttaccggc
cagagagtgacaagaatgatcagcaaaaggacttcgcgcagggtgcaaatcactggagtg
gagtttgcagcgcaccgatcaggggcccgaactattgttaacgctcgcaaggaagtactc
ctagcagcaggggcaattcacactcctcagctgctgcaattgtcaggaatcggtgacaga
gcaaccctcaacaggcataacatctccaccgtagccgatgtcccaggtgtcggccgcaac
ctccaggaccatcttcacgtccccgtagtgttttcattcgatttccccctaaccgccacg
aatcttacgacaaacagcacattcgccgctgaatcgtgggccttgtatcgcacccataag
acaggcccttacgccgacgcaactggcgacttccttgccttctttccaactgtaaacttc
acctctcaagctgatgtcctccagggcattgctgctgatcagaacccgcaagcctacctg
gacaaagacactccgccctcaattgtggacggctacgccgtccagcataaactcctcaca
agcggactcgccgctacggatgaagcgcagctcgaaatcatctgggcggacggcacgttt
gttctcggcctccagcatcccttttcacggggcagcgtgcgtctagcgtcatccgaccct
ttcgcgcaacctctcgcggaccctgcgtatctgcgtaatcctgtcgacgtgcggatccta
atcgaggcgatcaagtacgcgcgctcgttaaccacaaccctttctctggcggcatttaac
cccgtcgagctcgtgcccggtggcagcatcacctcggatgaagatctggaagcttatgtc
cgcggcgcagtagactcgctcttccatccatcaggaacttgtgccgtgggtaaatttgaa
cttggtggcgttgttgatgtggacttcaaggtacatggagtgaaaggtctaagagttgtg
gatgccagtgtgttaccaatgttgccggcgacgcatattcagagctcagtctatgcggtt
gctgagaaggccgcgaaggcgattctatcttag

DBGET integrated database retrieval system