KEGG   Aspergillus nidulans: AN4094.2
Entry
AN4094.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
ani  Aspergillus nidulans
Pathway
ani00100  Steroid biosynthesis
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
Module
ani_M00102  Ergocalciferol biosynthesis, squalene 2,3-epoxide => ergosterol/ergocalciferol
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    AN4094.2
Enzymes [BR:ani01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     AN4094.2
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295
Other DBs
NCBI-GeneID: 2873510
NCBI-ProteinID: XP_661698
UniProt: A0A1U8QK91 Q5B5T6
Position
II
AA seq 496 aa
MTSKKDKTPVPVQPVPEKRGYEFFGPYGAFAITFGLPVLLYGFTFLCNEVSGCPAPSLLH
PSTLTLDKLKEEVGWPEGGIRALYDTKVFLWVLGYYLLQLVLYVVLPGQVVEGTELACGG
RLRYKFNAFPTAVLILAGLAAGTYLDGADFVVWTFIWDNYPQVIAANLIICSSLAAFVYL
NSFSVPAPGKPNPELRQLAPGGHSGNVLYDFFIGRELNPRVRLPIPFVDEASRTIDIKVW
CEMRPGLLGWIIMNLSNIARQYRTFGYVTDSIVLSTALQAFYVLDGLYMEPALLTTMDVI
MDGFGYMLSFGDLVWVPFIYNLQTRYLAMFPNELGLRGIALVLAPTVVGYMIFRGANNQK
NRFRTNPNDPRVKDIKYIETASGSKLMTSGWWGLARHINYLGDWLMSWSYSLPTGVSGFV
IVNSVSPSTGELEKRAVQTPESRGAALLITYFFLIYFGVLLLHRERRDEEKCKKKYGKDW
DRYTSLVRSRIIPGVY
NT seq 1491 nt   +upstreamnt  +downstreamnt
atgacgtctaaaaaggacaaaactcctgttcctgtacagccggttccagagaagcgaggc
tacgagttctttggcccatacggcgcttttgctatcacctttggcctccccgtcctcctg
tacggcttcacgttcctgtgcaacgaagtctccggctgtcctgcgccatccctgctgcac
ccctcgacgttgacgctggataaattgaaggaggaagtcggctggcctgagggtggaatt
cgtgcgctttatgataccaaagttttcctctgggtgctgggctattacctgctgcagctg
gtgctttatgtagttcttccggggcaggtagtcgagggcactgaactggcttgcggtgga
agattgcggtacaagttcaatgctttccctaccgccgtgctgattctggctggtctggcc
gctggtacttacctggacggcgccgactttgttgtctggacatttatctgggacaattac
ccgcaggtcatcgccgccaacctgatcatctgctcgtcgcttgcagctttcgtctatctc
aatagcttttccgttcctgcgcccggcaaacctaaccccgagcttcgacagttggcgccc
ggggggcactctggcaacgtgctctacgatttctttatcggacgcgaactgaaccctcgg
gtgcgactcccaattccgttcgtcgacgaggcttctcggaccattgatatcaaagtctgg
tgcgagatgcgccctggattgctcggatggatcatcatgaacctgtccaatatcgcccgc
cagtacaggacgttcggatacgtgaccgattccattgtcctctcgacggcactgcaggct
ttctatgttctggacggactctacatggagccggctcttctgaccaccatggacgtgatc
atggatggtttcggatatatgctttcgttcggcgatctcgtctgggttcccttcatctac
aatctgcaaaccagataccttgcaatgttccctaacgaacttggcctgcggggtatcgct
ctcgtgctggccccgacagtcgtgggatacatgatcttccgcggtgccaacaaccagaag
aaccgcttccgtaccaaccccaacgacccgcgggtcaaggacatcaagtacatcgaaact
gcttctggctccaagctcatgacctctggctggtggggcctagcccggcacatcaactac
ctcggcgactggcttatgtcctggtcgtactccctgcccaccggggtttccggcttcgtc
attgtcaacagcgtgagcccgtccactggcgagctagagaagcgagccgtgcagacacca
gagtcgcgcggcgcagctctcctaatcacttacttcttcttgatctactttggagtcctg
ctcctccatcgcgagcgtcgcgatgaggagaaatgcaagaagaagtatggcaaggactgg
gatagatatacttcccttgttcgcagccgtattatcccaggtgtttactag

DBGET integrated database retrieval system