KEGG   Aspergillus nidulans: AN4159.2Help
Entry
AN4159.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01915  glutamine synthetase [EC:6.3.1.2]
Organism
ani  Aspergillus nidulans
Pathway
ani00220  Arginine biosynthesis
ani00250  Alanine, aspartate and glutamate metabolism
ani00630  Glyoxylate and dicarboxylate metabolism
ani00910  Nitrogen metabolism
ani01100  Metabolic pathways
ani01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AN4159.2
  09102 Energy metabolism
   00910 Nitrogen metabolism
    AN4159.2
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AN4159.2
   00220 Arginine biosynthesis
    AN4159.2
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ani04147]
    AN4159.2
Enzymes [BR:ani01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.1  Acid-D-ammonia (or amine) ligases (amide synthases)
    6.3.1.2  glutamine synthetase
     AN4159.2
Exosome [BR:ani04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AN4159.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Gln-synt_C Gln-synt_N
Motif
Other DBs
NCBI-GeneID: 2873585
NCBI-ProteinID: XP_661763
UniProt: Q96V52
Position
II
AA seq 345 aa AA seqDB search
MKYMSLDQRGSVMAEYIWIDAHGGTRSKTKTLSKAPSSVDELPEWNFDGSSTAQAPGDNS
DVYLRPVAMYPDPFRRGDNILVLCETWDSDGSPNKFNYRHDCARLMETHAKEEFWFGLEQ
EYTLLGPDGWPYGWPKGGFPGAQGPYYCGVGTGKVYCRDIVEAHYRACLYAGVKISGINA
EVMPSQWEYQVGPCHGIEMGDHLWISRFLLHRVAEEFGVKISFDPKPIKGDWNGAGLHTN
VSTTSTRAEGGIKAIESYMKKLEARHVEHIAVYGEGNEERLTGRHETGNIDKFSYGVADR
GGSIRIPRQVAKDGKGYFEDRRPASNADPYQITGIIAETVSFSNR
NT seq 1038 nt NT seq  +upstreamnt  +downstreamnt
atgaagtacatgagcctcgaccagcgagggtcggtcatggctgagtacatttggatcgac
gcccacggcggtactcgaagtaagacaaagactctttctaaggccccttctagcgttgat
gagctccccgaatggaatttcgacggttcatcaacagctcaggcccccggtgacaactca
gatgtctaccttcgccctgtcgctatgtaccccgatcctttccgtcgcggcgataacatc
ctcgttctctgtgagacatgggactctgatggaagccccaacaagttcaactaccgtcac
gactgcgcccgtctgatggaaacgcatgccaaggaggagttctggtttggtcttgagcaa
gagtacacccttctcggccctgacggctggccttacggttggcccaagggcggtttcccc
ggtgcccagggaccgtactactgtggtgtcggtaccggcaaggtctactgccgtgacatc
gttgaggcgcactaccgcgcctgtctctacgccggtgttaagatctctggtatcaacgcg
gaggtcatgccctctcaatgggagtaccaggttggtccttgccatggcatcgaaatgggt
gaccacctctggatctctcgtttccttctccaccgcgtcgccgaagagttcggtgtgaag
atctccttcgatcctaagcccatcaagggtgactggaacggtgccggtctgcacactaac
gtctcaacgacgtcaacacgtgccgagggtggcatcaaggccattgagtcgtacatgaag
aaacttgaagcccgccatgtcgagcacattgccgtctacggtgagggtaacgaggagcgt
ctcactggtcgtcacgagactggtaacatcgacaagttctcatacggtgttgctgaccgt
ggtggctccatccgaattccccggcaagtcgccaaggatggtaagggttacttcgaagac
cgccgccccgcttccaacgcggacccttaccagattactggtatcattgctgaaactgta
agtttttctaatcgatga

DBGET integrated database retrieval system