KEGG   Aspergillus nidulans: AN4321.2Help
Entry
AN4321.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01277  dipeptidyl-peptidase III [EC:3.4.14.4]
Organism
ani  Aspergillus nidulans
Brite
KEGG Orthology (KO) [BR:ani00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ani01002]
    AN4321.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.14  Dipeptidyl-peptidases and tripeptidyl-peptidases
    3.4.14.4  dipeptidyl-peptidase III
     AN4321.2
Peptidases [BR:ani01002]
 Metallo Peptidases
  Family M49: dipeptidyl-peptidase III family
   AN4321.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M49
Motif
Other DBs
NCBI-GeneID: 2872118
NCBI-ProteinID: XP_661925
UniProt: Q5B559
Position
III
AA seq 1178 aa AA seqDB search
MDANVKQHYLADSPPTVVRLEVKHHFDNLKDKNLRKYAHYISRAAFEGTRITLRQVSPES
EPIYDLILALYRACDGKWPELAQKTNVSDENLRFFLEYAAQFLGNSGNYKGFGDSKFIPR
LPLDAFEALASATPETKAAFQKANTTGGGIYETKEQSLMHLGYPESGHMTTYYPDSPSIT
KDEITAIGDFFEQKGMPLENTRLRMTASGDFELLIASGVSSPPSRDRDLGDVDSFDLDGK
LKGKKVHLVFGDHREEMAKIAHSVKQAGLYAANDTQKKMLDAYALSFGAGSIEAIKESQR
LWVKDQKPVLETNLGFVETYRDPHGVRGEWEGFVALTNPELPWGNEFEKDKFLSPDFTSL
EVLSFQSSGIPAGINLPNYDDIRQNLGFKNVSLGNVLSAKAPNEPIPFIPEADQDVYRNC
RDPAFEVQVGIHELLGHGTGKLLQETAPGEYNFDVSNPPISPVTGKPVSSWYKPGQTWSS
VFGAIASSYEECRAECVAMVLSCDFNILRIFGFGDGKENISNEAGDVLFAAYLQMARAGL
VALEFWDPKTKKWGQAHMQARYSILRTFLDAGDDFVKLAYTKDDLSDLEIKLDRSKILSH
GRPAVEKYLQKLHVYKSTADVEAGKALYDDITSVDEWWGTKVRDIVLKNKIPRKIFVQAN
TILEGDEVILKEYEPTLEVVVRSVIVGSRFAQVHAQASLNWWALDRQSRRVWITSNQRDG
RSCKSTSTPSLDSTTSRLPRTIAKNFDALSWPPDSRGSPPTARPPHLHDDDSFYTAPPPH
SPYSEASSSSFASSCPPPFSSLVFPSISDSHRPEPTALEPGCASPPAFVSPPSDGGLLEP
EPSSAVVAENKSPLVRDPKGEQSSEEGEPPPPYTEGDSPIDSFTYVMAAAGGASSIITQV
QQTGGPPINTLGDVGGDEHITLDLRGTRFTLSRDELLTLPEFVLLSLFPNGLLPDGHMNG
FHESDVYPVDYDPASLQYMLDFFRSVAQSIPSSASASPDLEVAPDSMQGSTRDMLQDRAG
IIVLREDLDFYVIPPRSDIDHGEMMEVKRSAAKALLRQDGIFSGLRKSDEPGSTEQHLIE
MLTAGGFDRDDHWGHRAPEPNKAVICSLALAKLRTDIRGDLASNNVGMAQKLLLFWRKPA
RRCWWEGVELDNVEGVEGKIKIWIRRVWTLEMSVIGLR
NT seq 3537 nt NT seq  +upstreamnt  +downstreamnt
atggatgccaatgttaaacaacactacctcgctgactcgcctccgactgtggtccgtcta
gaggtgaagcaccactttgacaacctcaaagacaagaacctacggaaatacgctcattac
atcagccgagcggcgttcgagggtaccaggataaccttgcgccaagtgagccctgagtct
gagccgatctatgatttaatcctcgccttataccgtgcctgcgatggaaaatggcccgag
ctagctcaaaagactaacgtcagcgacgaaaatctccgattcttcttggagtacgctgct
cagttccttggtaactctggtaactataagggctttggtgactcgaaattcattccacga
ttacccctagatgcttttgaggctctagcttcggccacgcctgagaccaaagctgcgttt
caaaaggccaatacaactggtggaggcatttacgagacaaaggagcagtctcttatgcac
cttggctatccagagtctgggcatatgacaacctattaccccgactcaccgtctatcacc
aaagatgagattacagccattggggacttctttgagcaaaagggcatgccactggaaaac
accagactccggatgacagcttcaggcgattttgagttactgatagcttccggcgtctcc
tctcctccctcgcgggacagggacctgggagatgtcgattcttttgacttggatgggaag
ctaaaggggaagaaagtgcaccttgtgtttggtgaccatagggaagagatggcgaagatc
gctcacagcgttaagcaggcgggactttacgcagcaaatgatactcagaagaaaatgcta
gatgcttacgcactgtcctttggagctggttccattgaggccatcaaagagagtcagcgc
ctctgggtcaaggatcagaagccggtcctggagacaaatctcgggtttgtcgagacatat
agggatcctcatggagtcaggggtgaatgggaggggtttgttgctttgactaaccctgag
ttaccttggggcaatgaatttgagaaagacaagtttctcagccctgatttcacttcgctt
gaagttctgagttttcagtcgtctggcatacctgctggtatcaatctgcccaactacgat
gacattcgccaaaacctaggtttcaagaacgtctctcttggaaacgtactttccgccaaa
gcaccgaatgagcccatcccgttcattccggaggcagatcaagatgtctaccgcaattgc
cgtgatcctgcatttgaggtgcaggttggtatccatgagttattgggacacggtaccggc
aagttgctccaggagactgcaccgggcgagtataactttgacgtgtccaatcctcctatc
agtccagtgaccggcaaacctgtgtcctcatggtataagccggggcaaacttggagctct
gtatttggagccattgcttcgtcctatgaagaatgcagagctgaatgtgttgctatggtc
cttagttgcgacttcaatattctcaggattttcggctttggagacggaaaggaaaatata
tcaaatgaggcaggtgatgttctatttgctgcatacctgcagatggctcgtgcgggtcta
gttgccttggagttctgggatccaaagacaaagaaatggggtcaggctcacatgcaggct
cggtacagtatcctgcgcactttcctcgacgccggagatgattttgtcaagctcgcttat
accaaggatgatctgtccgacctcgagatcaaattggatcgttccaagattcttagccat
ggacgcccagcggtggaaaaataccttcagaagctacacgtctacaagagcacggcagat
gttgaagctggaaaagccctttacgatgatatcacctctgttgacgagtggtggggcacc
aaagtccgcgatatcgttctgaagaataagattccccgtaagatatttgtgcaagccaac
acaattcttgagggtgacgaagtcattctcaaggagtacgagccgacactcgaggttgtg
gttcgaagtgtgattgtaggctcaaggttcgctcaggtccatgcgcaggcaagcctgaac
tggtgggctcttgatcgacagagtaggagagtctggatcacctccaatcaacgggacgga
cggtcttgcaagtcaacgtcaactccctcgcttgactcaactacatctcggttacctaga
accatcgcaaagaatttcgacgccttgtcgtggccaccggattctcgtggctcgcctccc
acggcgcggccgcctcacctccacgacgacgactccttctataccgcaccgccgccgcat
tccccctactcagaagcttcatcctctagcttcgcctcttcctgtcctccccccttttca
tcgctcgttttcccctcgataagtgacagccatcgtccagaacctacagctttagagcca
ggttgcgcttctcccccagcttttgtttctccaccttccgacggaggtctactagaaccc
gagccgtcctcggcggtagtcgcggaaaacaagtcacctttagttcgagatccgaaagga
gagcagagctccgaagaaggggaacctcctcctccatatactgaaggagacagccctatc
gactcgttcacatacgttatggcggcagctggaggcgcgtcgagtattattactcaagtg
caacaaacaggaggaccccccatcaacacccttggtgatgtcggcggcgatgagcatatt
acccttgatcttcgtggtactcgctttacgctctcccgtgatgaactattaaccctaccg
gaatttgtccttctgtcgctcttcccaaatggtttacttccggatgggcatatgaacggt
tttcatgaaagcgatgtatatcctgttgattacgatccagcttccctccaatacatgcta
gatttcttccgttctgtcgcccagtctatcccatcttcggcatctgcttctccagacctc
gaggtggcccccgattctatgcaaggctctacgagagacatgctccaagatcgagctggc
ataattgttttacgtgaagatctggacttttacgtcattcctcctcgatcagacattgac
catggagaaatgatggaggtcaagcgaagcgctgcgaaggctcttctacggcaagatggg
atattttcagggctgaggaaaagcgatgagccgggatctacagagcagcatctcatcgag
atgctcaccgccgggggatttgaccgtgatgatcattggggacaccgagccccagagcct
aacaaagcagtaatttgcagccttgcattggcaaaacttcgaactgatatcaggggtgac
ctagccagtaacaatgttggaatggctcagaagcttcttctgttctggcggaagcctgca
cgaagatgttggtgggagggcgtcgagttggacaatgttgagggtgttgaaggcaagatc
aaaatatggattcgcagggtctggaccctagaaatgagcgtgattgggctccgatag

DBGET integrated database retrieval system