KEGG   Aspergillus nidulans: AN4721.2Help
Entry
AN4721.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K12818  ATP-dependent RNA helicase DHX8/PRP22 [EC:3.6.4.13]
Organism
ani  Aspergillus nidulans
Pathway
ani03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:ani00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    AN4721.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:ani03041]
    AN4721.2
Enzymes [BR:ani01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     AN4721.2
Spliceosome [BR:ani03041]
 Complex C
  Other components
   Step II factors
    AN4721.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HA2 OB_NTP_bind Helicase_C S1 AAA_22 DEAD AAA_30 T2SSE AAA_19 DUF2075 AAA_16 SRP54
Motif
Other DBs
NCBI-GeneID: 2872518
NCBI-ProteinID: XP_662325
UniProt: Q5B409 A0A1U8QJ67
Position
III
AA seq 1241 aa AA seqDB search
MDDLQSLEHLSLISRITNELQNHLGVSDKVLAEYIIEQHLKCSSFAEFKSALEAMGGDLF
PMSLMESVDRLVLTMHPRYKNKNKKDRGDEHVENGASDDMDALNALEKKARVFKGLAVPD
QEPGWAEEEYMEVGNKNGLGVDEHDAKDSAMDDTFAMLEGLAGKARAKTTTITESRPVSK
RKRSRSRSPEYDDYSRRRRRDRYRSRSRSRSRSPAYNKRDEDPVDEFGRSTGGRSSNDDE
YRDGRSERRRRRRADEDYFRKPPPVELDDSPVLYKIYDGRVTGVKDFGAFVNLVGVRGKV
DGLVHVSAMQEGTRVNHPSDLVSRGQPVKVKVISIQGSRIGLSMKEVDQETGQDLVPQKR
LASGANMERLDGMPSDDRYGNLSADVPVIEESDGRSMKNRKRLTSPERWEIKQLIASGAV
SAADYPDIDEEYHATLTGEGTFEEEEDIDIEVRDEEPAFLAGQTKMSLELSPIRVVKAPD
GSMNRSAMAGTNLAKERRELRQQEAQDKAAEQAAGVDLNAQWQDPMASERKFAADLRSTQ
QTGTDEAVPEWKRVTMGKTPSFGKRTNMSIKQQRESLPVYKFRQQLLEAVAENQLLIVVG
DTGSGKTTQVTQYLAEAGWANKGIIGCTQPRRVAAMSVAKRVAEEVGCKLGAEVGYTIRF
EDCTSPETKIKYMTDGMLQREVLLDPDLKKYSVIMLDEAHERTIATDVLFGLLKTTLKRR
PDLRLIVTSATLDADKFSEYFYGCPIFSIPGRTFPVEIMYSKEPESDYLDAALITVMQIH
LTEPPGDMLLFLTGQEEIDTACEILYERMKALGPSVPELVILPVYSALPSEMQSRIFDPA
PPGGRKVVIATNIAETSITIDNIYYVIDPGFVKQKAYDPKLGMDSLVVTPISQAQAKQRA
GRAGRTGPGKCFRLYTEAAYQSEMLPTTIPDIQRQNLSHTILMLKAMGINDLLHFDFMDP
PPTNTMLTALEELYALSALDDEGLLTRLGRKMADFPMEPALAKVLIASVDMGCSEEMLSI
VAMLSIQSVFYRPKEKQQQADQKKAKFHDPHGDHLTLLNVYNAWKRSGFSNAWCYENFIQ
ARQIRRAQDVRQQLLGIMQRYHHKIVSCGRNTTKVRQALCTGFFRNSARKDPQEGYKTLV
EGTPVYMHPSSAMFGKPAEHVIYHTLVLTTKEYMHCTTGIEPKWLVEAAPTFFKVAPTDR
LSKRKKAERIQPLHNRFAGEDDWRLSAQRRQGRGGGGGTWG
NT seq 3726 nt NT seq  +upstreamnt  +downstreamnt
atggatgaccttcaatcactcgaacacctctccctcatatcgcgcataacaaacgagctt
caaaatcacctgggagtaagcgataaagttctcgccgagtacatcatagagcaacattta
aaatgttcttcgtttgccgaattcaagagcgcgctagaggcgatgggaggtgacctattc
ccgatgagtttaatggaaagcgtggatcgattagtgcttacgatgcatccgagatataaa
aacaaaaataagaaagacaggggtgatgaacacgttgaaaatggggcaagcgatgatatg
gatgcgttaaatgccttggagaagaaggcgcgtgtcttcaagggcttggcggttccggac
caggagccgggatgggcggaggaggagtatatggaggttgggaataagaacggattggga
gttgatgagcacgatgcgaaggatagtgcgatggatgatacattcgcgatgctggagggg
ttggcagggaaggcgagggcgaaaacgactacaataacagagtcacggccagtatcgaag
aggaagcggagtcgtagtcggagtccagagtacgatgattatagccggcgccgacggagg
gatcggtatcgttcgaggtcgagatcgagatcgcggagtccggcttataataagagggat
gaggatccagtggatgagttcggccggtcgactggtggccggtcctcaaatgacgatgaa
taccgcgatggacggagtgaacgccggaggaggagacgagccgacgaagattactttcgc
aaacctccgcctgttgagctcgatgactcgcctgttttgtataaaatctacgacgggcga
gttacgggtgtgaaagacttcggcgcgtttgtgaacctggtgggcgttaggggaaaggtt
gacgggctggtgcatgtatctgcgatgcaggagggtacgcgtgtgaatcatccctcagac
ttggtatctcgcggtcagccagtgaaggtcaaagtgatcagtatacaaggctcacgcatt
ggcctatccatgaaagaggtagaccaggagactgggcaggatctagtcccgcaaaagcgc
cttgcatcgggagcgaatatggagcgactagatggcatgccatcagatgatagatacggc
aacctcagtgcggatgtgcctgttattgaggaatccgacggccgatctatgaagaaccga
aagcgtctaacatccccagagcgctgggagatcaagcagttaattgcgtccggggccgtt
tccgcagctgattacccagatattgacgaagaatatcatgctaccttgaccggagagggc
acatttgaagaagaggaagacattgatatcgaagttagagacgaagaacctgctttcctg
gcgggtcagaccaagatgtctctggagctgtctcctatccgagttgtcaaggctccagat
ggatccatgaaccgctccgcaatggcaggtacaaatctagccaaggaacgaagagagctc
aggcaacaggaggcccaggacaaggcagccgaacaggcagctggggtggatctcaacgcg
cagtggcaggatcctatggctagtgagcgaaaatttgcggccgacctccgttctactcag
caaacggggactgacgaagcggttccggagtggaagagggtcacgatgggcaaaaccccg
tcattcggaaagcggacgaatatgtcaatcaagcaacagagagaaagtctgccggtctac
aaattccgccagcagctgctggaggccgtagcggaaaatcagctactgattgttgtcggc
gataccgggtcagggaagacaacgcaagtgactcagtatttggctgaggcaggctgggcc
aataagggaattatcggatgtacccaacctcgccgtgttgctgcgatgtcggttgctaag
cgtgtggctgaggaagtcggctgcaagcttggtgcagaggttgggtatacaatccgtttt
gaggattgtactagcccagagacgaagatcaagtacatgacggatggaatgctccagaga
gaagttttgctagacccagacttgaaaaagtattctgtgattatgcttgacgaagctcac
gagcgaaccatcgcgactgatgtcctctttgggctgctgaagactacactcaagcggaga
ccagacttgaggctcattgttacgtccgccacgctagacgctgataagttctctgagtac
ttctacggctgtcccatcttctctatccctggtcggacattccctgtggagatcatgtac
tcgaaagaacctgaatcagactacctagatgcagctctcatcaccgtcatgcagattcac
ttgactgagcctcctggcgatatgctgctgttcttgaccggacaagaggaaattgacaca
gcgtgcgagattttatatgagcggatgaaagctctcggtccaagcgtcccagagttggtg
atcctcccagtctactcagcgctacccagcgaaatgcaaagtcgcatattcgaccctgca
ccccccggcggccggaaggttgtcattgccacaaacatcgcagaaacctccatcacaatc
gacaacatctactacgtcattgacccgggtttcgttaagcaaaaagcctacgacccaaag
ctggggatggactcactagtcgtaacaccaatctcccaggcgcaagccaaacagcgtgcc
ggccgagcaggccgaactggtcctggaaaatgcttccgcctctacaccgaagccgcatac
caatccgagatgctccctaccactattcccgacattcaacgccaaaacctgtcgcatacc
atcctcatgctgaaagcaatgggcatcaacgacctgctccacttcgactttatggatcct
ccgccgacaaacaccatgctcacagctttagaagagctttacgcactatccgcactagat
gacgaaggtcttttaacacgtctaggccgcaaaatggccgactttcccatggagccagcc
ctagctaaggtcttgattgcttccgtcgacatgggctgctctgaggaaatgctctccatc
gtcgccatgctctccatccaatccgtcttctaccgtcccaaggaaaaacagcaacaagca
gatcaaaagaaggccaaatttcacgacccccacggcgatcatctaacgttactcaacgtt
tacaacgcctggaaaagatccggctttagcaacgcctggtgctacgaaaatttcatccaa
gcacgccagattcgccgcgcgcaggacgtccgccagcaactccttggcatcatgcagcgc
tatcaccacaaaatcgtctcatgcgggcgcaacactaccaaggtgcgacaggctctttgc
acagggtttttccgcaattcagcacgcaaggacccgcaggaagggtataagacgcttgtc
gagggaactcctgtgtacatgcatccttcttctgcaatgttcggcaagcctgctgagcac
gtcatataccacacgcttgtgctgacgacgaaggagtacatgcactgcacgacggggatc
gagccaaagtggcttgttgaggcggcgccaaccttcttcaaggtcgcgccaacggatcgc
ctgtccaagaggaagaaggcagagaggatccagccgctgcataatcgctttgctggcgag
gatgattggcgcttgtcggcacagagaaggcagggcaggggtggtggcggtgggacttgg
ggctag

DBGET integrated database retrieval system