KEGG   Aspergillus nidulans: AN5151.2
Entry
AN5151.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K07297  adiponectin receptor
Organism
ani  Aspergillus nidulans
SSDB
Motif
Pfam: HlyIII Asr
Other DBs
NCBI-GeneID: 2871444
NCBI-ProteinID: XP_662755
UniProt: A0A1U8QF38 Q5B2S9
Position
V
AA seq 498 aa
MACSTGSVTIESYLDTAVSSATPSEETALLRDRKRRHSFHTARKLSCDYDADAIFLRVEL
FLAELERRLHWIEQYRKSHMVQIDTSLRRAYATLEAVRDSCSHASGELMGSGKKRAKILV
ETLESRYNDALATKETLEQKAQAGVRLMESFLTELESRADAVRDRGVYGALDDGWKAVDS
TLVQAREVMDEGIERARQVKDALRENIDHAIMLAKEKRLISYSDLPAPWRINPHILSGYR
FHSSKVECLTSVFTFSNELVNIWSHLIGLIIVLSIAFYFYPLNPNFHLSTNSDTLVAAVF
FFAACKCLVCSTLWHTMNSIADQPLMERFACVDYTGISLLVAASIVTTEYTAFYCEPTSR
WVYILLTMSLGIGGVILPWHPTFNRADWAWVRVAFYVTLALTGFAPLAQLTYARGFSWCL
YFYAPVMKSILVYFVGACVYASQIPERWKPGLFDYIGGSHNIWHLAVLGGILFHYLAMQD
LFANAFQRAKGECPNLTS
NT seq 1497 nt   +upstreamnt  +downstreamnt
atggcttgctctactgggtctgtgaccatcgagtcgtatctcgataccgctgtctcgtca
gccactccgtccgaggagaccgctctgcttcgagatcgcaagcgaagacattctttccat
acggcgagaaagttgtcctgcgattatgatgcggacgctatttttctaagggtcgaactt
ttccttgcggaattggagagacgccttcactggattgaacaatatcgcaagtcgcacatg
gtccagatcgacactagcctacgcagggcctatgctacgctggaagctgtgagagattct
tgctcacacgcctcgggggagttgatgggcagcggcaagaagagggctaagatcttggtg
gaaaccctggaaagtcgttacaacgatgcgttggcgacaaaggaaacattggagcaaaag
gcccaagccggcgtgcgtttgatggaatcttttttgacggagttggaatctcgcgctgac
gccgttcgggatcgcggtgtttacggagctttggacgatggctggaaggcagtcgactcg
acgctggttcaagcaagggaggtgatggacgagggtatcgaacgggctcgccaagtcaag
gacgccctccgcgagaatatcgaccatgctattatgctcgccaaagagaagcgcttgatc
agctactcggatctaccggcaccatggcggataaacccgcatatcctctctggatatcga
ttccactcgtctaaagtggagtgcctaacttcggttttcaccttctccaatgagcttgtc
aacatctggtcgcacctgatcggcctcatcatcgtcctctctatcgccttctacttctat
ccactgaaccctaattttcacctaagcacgaattccgacacgctcgtcgctgcggttttc
tttttcgccgcctgcaaatgcctggtctgcagcaccttatggcacacaatgaacagcatc
gccgatcaaccactgatggagcgcttcgcttgtgtggattacactggcatctccctcctt
gtcgccgcgtccattgtaaccaccgagtacacagcgttctactgcgaacccacatcccgc
tgggtctacattctccttactatgtccttaggaatcggcggcgtcatcctcccctggcac
ccaaccttcaatcgcgctgattgggcctgggttcgcgtcgccttctacgtcactttggcc
cttaccggatttgccccccttgcccaactcacctacgcgcgtggcttctcgtggtgtctg
tatttctacgctcccgtcatgaagagtattctcgtctacttcgtgggtgcctgcgtctat
gcctctcaaatcccggaacgctggaagccaggtctattcgattacatcggcggcagccac
aacatctggcaccttgctgttcttggcggcatcctattccactaccttgccatgcaggac
ctcttcgccaacgctttccagcgcgcaaagggtgaatgccctaacctcacctcttga

DBGET integrated database retrieval system