KEGG   Aspergillus nidulans: AN5180.2
Entry
AN5180.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
Organism
ani  Aspergillus nidulans
SSDB
Motif
Pfam: CDV3
Other DBs
NCBI-GeneID: 2871474
NCBI-ProteinID: XP_662784
UniProt: Q5B2Q0 A0A1U8QK64
Position
V
AA seq 881 aa
MALVHSPIPVPPDAERPEIDTETVEELWEDKHNHNDGQKTVDTALGDDTTQRPLSLFERV
ITTHTPILESLLLQTPTAAILNLSHTSRYLRSFLRSYPTAWKYLSFRLLYPSGTQSPLRI
ILPGASDPRTPRQSRPYALDQLLMNVVVPFSPCLKSLELDNTAVSGQILIATVLNPRRET
LEHVSVRGCKNVSLKYHIIPYLTMFGLQYDVSMENSIGSSPATQRLALKSLYTYRCRHHR
RRPYLSSSLTRKDSDSEPTHELVNLCHKLGIWTDTAWCSTPAGRCFRRRGYVAMRAPQGS
PEVWVVFDRLWRSKNWIGPIEGSSSRPTQRDGKLWEHDETGCFGEALGTGEKRDIGEGKM
LPAHLRRSHRRFVENIRCDNCCELVSERCEQCSILMHCVGCRKTLCASCAYERPYLHAQA
SKNTTTGSFWWAPGATTSPCSMHDPAENAEDPAAQPNTPLSYPALKFHWCCTEPIFSGGG
GISIGTPNRDVDQVRAAPLPRGEGWEDLEYSAQEWSKSFPKYAYGDPHKPDYSLEAGHIA
MMKWLLGPPDRQPSACPRNLCKECYDTPQWKVHCKTCSKPLCIEHDLRGLRLRICGYRDL
TLEKLAIQNRTETTAVSQTDEPAPPLQNTATTGFDLPYRTQRTVDSTTSSFTEDHPADVN
PQPSTTSSSAVPPLRRSRSISASNSNRSRSSSPSIYSDSPVEQQTPKWQGCQSFFCPQYR
PIGDQRSRCASVLRECTSCSVFVCQDCVSRHPPCKCSYCETNYLCPNCAKLRDRDGTCRR
AEEEKARREQKLQRDMQTLERILETKLANEVAEYAGQFFGFVDSSNSTGLPNSVLAASDE
EVEVEVDVEAPHHPSASSPHHVDVHESLQLLLIQTLLGSNE
NT seq 2646 nt   +upstreamnt  +downstreamnt
atggcgctcgtccacagtccgatacccgtaccgcctgatgcggagaggccggagatagac
accgagacagtggaagagttgtgggaagacaagcacaatcacaacgatggccagaagacg
gtagatacagcattgggcgacgatacaacacaacgccctctgtctttattcgagcgagtc
attaccacgcacaccccaatccttgaatccctcttactccagacgccgaccgcagccatc
ctcaatctctcccacacctcgcgctacctacgatcctttctccggtcgtatccaacagca
tggaaatacttgtcgttccgcttgctatacccctccggcacgcagtcgcctctgcggatt
atcctcccgggggcgtccgaccccagaacaccacgccagtctcgcccgtatgctttggac
cagctgctgatgaatgtggtggtgccgtttagcccgtgtctaaaaagcctggagctggat
aacacggcggtatctggacaaatactcattgcgaccgttttaaatccgcggcgggagacg
ctggaacacgtctctgtgcgcgggtgcaagaatgtctcgctgaaataccacatcatccca
tacctgaccatgttcgggttgcagtacgatgtcagcatggagaacagcattggcagctct
ccggccacgcagcgtcttgcgctgaaaagcctctacacttatcgatgtcgccatcaccga
agacggccttatctctcttcgtctcttacgcgaaaagattccgactctgaaccgactcat
gaattggtgaatctctgtcataagcttggaatctggacggatacggcgtggtgctcgacc
ccggctggaaggtgtttccggaggcgaggatatgtggcaatgcgtgctccgcagggctca
ccggaagtgtgggtggtgtttgatcggctgtggaggtcaaagaattggatcggcccaatt
gagggatcaagcagtcggccaacacagagggacggtaagttgtgggagcacgatgagact
gggtgcttcggtgaagctcttgggaccggggaaaagagagacataggagaggggaagatg
ttgccagcacacttgcgtcgtagtcaccgacggtttgtcgagaatatccgctgtgacaat
tgctgcgagttggtttcggagcgatgcgagcagtgcagtatcctgatgcattgcgtcggg
tgtcggaaaactctctgcgccagctgtgcctacgaacggccataccttcacgctcaagcg
tcgaagaatacaacgacaggttctttttggtgggctccaggcgctactacttcgccctgt
tcgatgcacgatcctgctgagaacgctgaggatccagcggcacagcccaacacccctctg
tcgtatcccgcattaaaattccactggtgctgcaccgagccgatattctctggaggcgga
ggtatcagcattggcacgccaaatcgcgatgtcgatcaagtccgcgcagctcccttgccc
cgtggcgagggctgggaagaccttgagtactccgcgcaggaatggagcaaatcgttcccc
aagtatgcctacggtgaccctcacaaaccggattacagccttgaagctggacatattgca
atgatgaagtggctgcttggtccgccagatcgacagccttccgcttgtcctcgaaatctc
tgcaaggagtgctatgacacgccccagtggaaggttcactgcaagacatgttcaaaaccg
ttatgcatagaacatgatctgcgtgggctacgcctacggatatgtggatatcgtgatctt
acactagaaaagctagctattcagaaccgaactgagacgacggcagtatctcaaacggat
gagccggcgccacctctccaaaataccgcaactacaggtttcgaccttccatacagaacg
cagcgaacagttgattccactacgagcagtttcactgaagaccaccctgccgacgtcaac
ccgcaacccagtacaacatccagctccgcagttccacccctccgccgctcccgcagcata
tccgcctcaaattccaaccgatcccgatcatcttctccatccatctactctgactcgcct
gtggaacaacaaaccccgaaatggcaaggctgccaatctttcttctgccctcaataccgc
cctattggcgaccagcgctcccgctgcgccagcgtcctgcgcgaatgcaccagttgctct
gtctttgtttgtcaagactgcgtgtcccgccatccaccttgcaaatgctcctactgcgaa
accaactacttgtgtccgaactgcgcgaaacttcgagaccgtgacgggacttgccgtcgt
gcagaagaggaaaaggctcgccgcgagcagaaactgcagcgcgatatgcagacgttagag
cggattctggagacgaagcttgccaatgaagttgcggagtatgcgggacaattctttggc
tttgtcgattcctcgaactcaacgggtcttcctaactcggttttggccgctagcgatgaa
gaagtggaagttgaggtcgatgtcgaggcacctcatcatccttctgcttcgtctccccac
cacgtcgatgtgcacgaaagcctgcagcttcttcttatccaaactctgctaggctctaac
gaatag

DBGET integrated database retrieval system