KEGG   Aspergillus nidulans: AN5224.2
Entry
AN5224.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K20044  phosphatidylinositol-binding clathrin assembly protein
Organism
ani  Aspergillus nidulans
Brite
KEGG Orthology (KO) [BR:ani00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ani04131]
    AN5224.2
Membrane trafficking [BR:ani04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    AN5224.2
Motif
Pfam: ANTH ENTH
Other DBs
NCBI-GeneID: 2871518
NCBI-ProteinID: XP_662828
UniProt: A0A1U8QYK3 Q5B2K6
Position
V
AA seq 593 aa
MAQNFEKSVKGATKVKLAAPKSKYIEHILVATHTGEAGVAEIFRTLHLRVRDSTWTIAFK
ALIVIHFMIREGQLDATLQYMAENPRKIAVHGLSEVQPQGRNIRRYAQYLLARAKAFEQT
KTDYVRSGQGRMKRLTVDKGLLRETEIVQKQIKELLRCDYQLLTDEVENEISLTAFRLLT
LDLLTLYSVMNEGTINVLEHYFEMSRPDSERALEIYKTFTAQTEEVVKFLGVARHFESAT
RLEIPKLKHASTDLTRLLEDDLNDPDFNQRRREYLARKGKSVSSSAFAAASTTGDKPASN
SNPTPPRPKTEPSPQTKAAPSNLIDFFDSIEPAQPAQFQQQPQQQGMQFQQTGGFPGQEP
AFYPQQTGFQQPQPTGLNQQAPFGGPFAPQTTNQFGQQQVPAPLQATPTGAGFGGYTPQP
QAQGFQSQLPPIPQNNVAAFPQQQQSPATLQPQTTNPFRQSMLMSTPTGSAVPPSPLNRQ
STNPFAKRLSTANPSFPQSQPSQQPQQPAALQPQRTGTNPFARSSSVPPQQSQSLHPSAA
PLRPTPTGSTNPFRQSTLVQQGQGWQTTNGQQGTMGGLEQLETISVFPRPGYS
NT seq 1782 nt   +upstreamnt  +downstreamnt
atggcccaaaacttcgagaaatcggtaaaaggggctaccaaggtcaagcttgcggccccc
aaatccaaatacatcgagcacatcctggtggctacgcatacgggcgaagctggagtggca
gagatattccggacactgcaccttcgggttcgcgattcgacatggacaatcgctttcaag
gctctcatcgtgatccacttcatgatcagggagggccagctggacgcaacgctgcagtat
atggcggagaatccgaggaaaatcgctgtccacgggctatcagaggtccaaccgcaaggc
cgcaatattcgacgatacgcccagtacctcctcgctcgcgcaaaagcatttgagcagacc
aagaccgattatgtacggagcggccagggccgcatgaagcgtcttacagtcgacaagggc
ctactacgagagacagaaattgtacagaagcagatcaaggagctcctgcgatgcgattat
cagctcttaaccgatgaagtcgagaacgaaatcagcctgacggcattccgtcttcttact
ctggaccttttgactttatactccgtcatgaacgagggcacaataaacgttctagaacac
tattttgaaatgtcgcgccctgatagtgagcgcgcgctggagatttacaagaccttcacc
gcgcaaactgaggaagttgtcaagtttttgggagttgctcgacatttcgagtcggccaca
aggctagagattcccaagttaaagcacgcttccaccgatctcacacgtctcctcgaggac
gacctgaacgatccggatttcaaccagcgccgcagagagtatcttgctcggaaaggaaaa
agtgtaagtagcagtgctttcgcagcagcctcgaccacgggtgataagcccgcttccaac
tcaaatcctacgcctcctcgacccaagacggagcctagccctcagacaaaggcagcccca
tcaaaccttatagacttctttgactcgattgagccggcccagccagctcagttccagcag
cagccgcagcaacagggcatgcaattccagcagaccggcggcttccctggacaagagcct
gctttctacccacaacagacaggattccagcagcctcaacccacgggattgaaccagcag
gcgccatttggaggcccgtttgccccgcaaaccaccaaccagtttggccagcaacaagtg
cctgctccccttcaagcaaccccgaccggtgccggattcggtggctacacaccgcaaccc
caggctcaagggttccagtcgcagcttcccccgatcccgcagaacaatgtcgctgcattc
ccccagcagcaacagtcacccgccactctccaaccgcagacgaccaatccttttaggcag
tccatgttaatgagcacgccgacggggtcagctgtgccgccatccccactgaaccgccag
agcacaaacccgttcgcgaaacggctatcaacagcgaacccgtcgtttccccagagtcag
ccgtctcaacagccccagcagccagcagctctccaaccccagcggacgggcacgaaccct
ttcgctcgaagttcgtctgtcccaccgcaacagtcacaaagcctgcatccttctgccgca
cctcttcggcctacacccacaggaagcacaaatccgttccgacaaagcacacttgtgcaa
cagggccaggggtggcagacgaccaacgggcaacaaggcaccatgggcgggctggagcag
ctggaaacgatctccgtgttcccacgaccgggatactcgtga

DBGET integrated database retrieval system