KEGG   Aspergillus nidulans: AN5426.2Help
Entry
AN5426.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
ani  Aspergillus nidulans
Pathway
ani00260  Glycine, serine and threonine metabolism
ani01100  Metabolic pathways
ani01110  Biosynthesis of secondary metabolites
ani01130  Biosynthesis of antibiotics
ani01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ani00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AN5426.2
Enzymes [BR:ani01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     AN5426.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 OKR_DC_1
Motif
Other DBs
NCBI-GeneID: 2871719
NCBI-ProteinID: XP_663030
UniProt: A0A1U8QVZ9 Q5B204
Position
V
AA seq 328 aa AA seqDB search
MASASLGDDVFEEDETTNEFQSLMAAQCGLEAGAFVVSGTMANQLAIRTLLTQPPCRVLV
DSQSHIAAHFQEGGLGMSGASLQTIRPSNGRYLVLEDIMTRIIVTNDVHKGPTRVISIEN
TAGGSVVPLAELRRIREWADRNRVAVHMDGARLWEAVATGRGSLSEYCTLCDLVSLDFSR
NLGAPMGAMVLGSTQLIARLRRIRKSIGGALRQSGPIAAAAQFAFMEQFGLGPWGSRGKL
RAVHLLAKQVGQMWVDLGGELLREVETNQVWVNLDNADITVDRWNELGRKYGVKLEGERI
VLHHQISADSIDQLGLVFEEALKLRPNL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgccagcctgggagacgacgtcttcgaggaagatgagacgacaaacgagttc
cagtcgcttatggccgcccaatgtggccttgaagcaggggcgtttgtagtttcgggaaca
atggcaaatcagttggccattaggacgctattgacacagccgccttgccgtgttctcgtt
gattcgcaatcacatatcgccgcccattttcaagaaggcggactcggtatgagtggtgcc
tccctccagacgatccggccatccaacgggcgatacctggtcctggaggacatcatgacg
cgaattatcgtcaccaacgatgtccacaaagggccgacacgagtcatcagtatcgaaaac
actgctggcggcagtgtagtgcctcttgctgagctgcgccggatccgcgagtgggctgat
cgcaaccgcgtcgcggtccatatggatggtgctcgattatgggaggccgtagccacgggg
cggggcagcctgtctgagtattgtacgctctgcgacttggtctccctggactttagcagg
aatctcggtgcgcccatgggcgcaatggtgcttgggtcaacccagctcatagcccggctg
cggcgaatacgcaagagcattggtggtgccctcaggcagtccggtcctatcgccgcagcc
gcgcagtttgcctttatggagcagtttgggctggggccctggggaagtcgaggaaagcta
cgtgccgttcatttgctggcgaagcaggtgggccaaatgtgggtggatctgggaggagag
ctgctgcgcgaggtcgagacgaatcaagtctgggtcaatctggataatgcagacataacg
gttgatcgatggaacgagcttgggaggaagtatggggtcaaactggagggggagcgaatt
gttttgcatcatcagatctcggctgattctatcgatcagctcggtcttgtatttgaggaa
gccctgaaattgcgtccgaacttgtga

DBGET integrated database retrieval system