KEGG   Aspergillus nidulans: AN5527.2
Entry
AN5527.2          CDS       T01016                                 
Name
(RefSeq) hypothetical protein
  KO
K10875  DNA repair and recombination protein RAD54 and RAD54-like protein [EC:5.6.2.-]
Organism
ani  Aspergillus nidulans
Pathway
ani03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ani00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AN5527.2
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ani03400]
    AN5527.2
Enzymes [BR:ani01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.-
     AN5527.2
DNA repair and recombination proteins [BR:ani03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    Rad54 family proteins
     AN5527.2
SSDB
Motif
Pfam: Vac14_Fig4_bd SNF2-rel_dom Rad54_N Vac14_Fab1_bd Helicase_C HEAT_EZ ResIII HEAT Cnd1 HDA2-3
Other DBs
NCBI-GeneID: 2871816
NCBI-ProteinID: XP_663131
UniProt: Q5B1Q3
Position
V
AA seq 1776 aa
MTNSSGQPRRSSHTSHKRTSALKSSQLSRSRSRKSCLSYKCLIVEASRVSASSNSIDRLS
KPFKCPGSATPTRASDKPARKRRKVNYAGADGSIDDNSVKPYTNEERLALATRDVNRFPV
FKAKDKDVAFKQKFKVPLINKSTGTYDSSRPAPTLGMRQGASFVVKPLHDPSGEFAIVLY
DPTVDDIDEVKPEKQDNDASDKIQKLDEPIVHKSLADILGLKKKVENRPKVPVVIDPRLA
KVLRPHQVQFLYRCTTGMIDRNAHGCIMADGMGLGKTLQCISLMWTLLKQSPEAGKTTIQ
KCIIACPSSLVGNWANELGKWLGKDTITPFAVDGKASKTELTSQLKQWAISSGRSIVRPV
LIVSYETLRMYVDTLKDSPIGLLLCDEGHRLKNKESLTWTALNSLNVQRRVILSGTPIQN
DLSEYFALLNFANPDLLGSQNEFRKRFEIPILKGRDAAGTEEDRKKGDERLAELSSIVNK
FIIRRTNDILSKYLPVKYEHVVFCNLSQFQLDLYKHFIDSPEIKSLLRGKGSQPLKAIGI
LKKLCNHPDLLNLSTDLPGCEHAFPDDYVPVEARGRDRDVRPWYSGKMMVLDRMLARIRQ
DTNDKIVLISNYTQTLDLFEKLCRSRAYGCLRLDGTMNVKKRQKLVDKFNDPDGEEFVFL
LSSKAGGCGLNLIGANRLVLFDPDWNPAADQQALARVWRDGQKKDCFVYRFIATGSIEEK
IFQRQSHKQSLSSCVVDSAEDVERHFSLDSLRELFQFKPGTTSDTHDTFKCKRCRADGTQ
YIKAPAMLYGDTSSWNHFVNTGEKGPLNQIQDLLIRQETQERDVSAVFQYIIGAYLQDSQ
SSYIVCVLAPTRHVRRVRMVEPPYVTPLLAPCQRIFTDSSPHDFVTTRQLEKVVRDAAFR
GDHEVIQKIVDQLCHDYAYAIIDSETGELQEGVAPYLKEIVPPVLACFSDQDARVRYYAC
ESMYNIAKVAKGEILLFFNEIFDALSKLASDSELSVKNGAELLDRLVKDIVSESAAHHVS
VLQLSEKQSSDPDDLGDDLPTAFSLPKFIPLLKERIHVLSAFTRTFLVSWLTLLDTIPDL
ELVSYLPEFLAGLIKFLGDPNRDVNVATQGLLDRFLAEIKRIARLKKGLAESRKGQGSDN
RRSMTSDNISLATDPTTALDAESNENAVEDSEADFAVEDEEGLHTDGDWIPGQDVQIDYP
KILDILVGFVDTSYGPDEEMQLTALRWIDSFFEISPEDILPFVPRLLDQVLPALSSSSTA
VKETAGRVNASLLEYIFSLTLSEDTSDDSRQTSASKLPSAITKELAERRSSTPTSKADIS
GVESKKASPRNSVSSAVPSPPPELDYGAAVTSLTLQFLSEYETTRIAALSWLIMLHRKAP
KKVAAFNDGIFPALLKTLSDPSETVVTKDLQLLSQISRNSEDSYFKLFMVNLLQLFSTDR
NLLEIRGNLIIRQLCLNLSPERIYRTLADCLEKEDDIEFASIMVQNLNNNLITAPELSEL
RKRLRNLDSREGQTFFVALFRSWCHNAVSTFSLCLLAQAYEQAYNLLQVFAELEMTVNML
IQIDKLVQLLESPVFTYLRLQLLEPERYPYLYKCLYGVLMLLPQSSAFAALKNRLNSVSN
IGLLHTGPRLSTMASTSTSGASTYDRTSGRLKQRDENSIRWVDLLDKFKSVQEKTRSSQR
SQRPFDANDARTHQTTTLSAAISNADQIRRDKTLPDTPRAAFGGAGGRASPADGGNAGSV
VAGGAAGKGGILGPQRQKSGLPNLGRLRIGGGKNKR
NT seq 5331 nt   +upstreamnt  +downstreamnt
atgacgaatagtagtggacaaccacgcaggagttcacatacctcgcacaagagaactagt
gctctcaaatcgagtcaactgtcgaggagcaggtcaagaaagagctgcctctcctataaa
tgcctaatcgttgaagcatcgcgcgtcagcgcatcctcgaactccatcgaccgcctctcg
aaacctttcaaatgccctggatcagctacaccaactagggcttcggataagcctgcaaga
aaacgaaggaaggtgaattacgccggggccgatggaagtatcgacgacaatagcgttaaa
ccatataccaatgaagaacgccttgcgcttgccactcgggacgtcaacagatttcctgtc
ttcaaggcgaaggacaaagacgtagcgttcaagcaaaagttcaaagtgcctttgataaat
aagtcgaccggcacgtacgacagctcgcgacccgccccaaccctggggatgaggcagggt
gcctcatttgtggtaaaacctttgcatgacccaagtggagagtttgcgattgtcctctac
gacccaaccgttgatgatatcgatgaggtcaagcccgagaaacaggataatgatgccagt
gataagattcagaagctggatgagcctatcgtgcataagagcttggcggatatccttggg
cttaagaagaaagtggaaaaccgtccaaaagtcccagttgtgattgatcctaggctagca
aaggtcttacgtccgcatcaagtccagttcctctaccgctgcactactggaatgattgat
agaaacgcccatggttgcatcatggcagacggaatggggctaggaaagactcttcaatgc
atttctttaatgtggacacttctgaagcagtcccccgaggctggaaagacaaccatccag
aaatgcatcattgcatgcccgtcgagtttggtgggtaattgggccaatgaacttggcaaa
tggcttgggaaagatactatcactccgttcgcggtggatggcaaagcatcaaaaacagag
ctcacaagccagttgaaacaatgggcaatctcctccggccgctctatcgttagaccggta
ctcattgtttcctatgaaacactgcggatgtatgtcgatactttgaaggatagcccgatt
gggctgctcctctgtgatgaaggtcacagattgaagaataaagaaagtttgacttggaca
gcactcaacagtctgaatgtgcaacgccgagtgattctgtctgggacgcctattcagaac
gacctttcagaatattttgcacttctcaatttcgccaatccagaccttcttgggtcgcaa
aacgaatttcgaaagagatttgagatacccatcctcaaggggcgagatgcagcaggcacg
gaagaagacaggaagaaaggcgatgaacgtctggcagagctttccagtatcgttaacaag
tttatcattcggcggacaaacgacattttgtccaagtacttgccagtcaagtatgaacat
gttgttttctgcaatctttcacaatttcaactggacttatacaaacatttcatcgatagt
cccgagatcaaaagtcttctcaggggcaaaggcagtcagcctctgaaagcgatcggaata
ctgaaaaagctctgcaaccatccagacttactgaatctttccactgatcttcccgggtgt
gagcacgcattccctgatgattatgtccctgtggaagcaaggggtcgagacagggacgtc
agaccttggtattctgggaaaatgatggtgcttgaccggatgctggcgcgaatacgccag
gatacaaatgacaaaattgttctaattagcaattatacacaaacactcgatttgtttgaa
aagctttgcaggtcaagagcatatggttgcctgagactggacggtacgatgaacgttaag
aaacgacagaagctggtcgacaagttcaacgaccccgacggcgaagagtttgtattcctt
ctcagcagcaaagccggtgggtgtggtttgaacttgatcggtgctaatcgacttgttttg
ttcgatcccgattggaacccggcagcagatcagcaggcactcgcgcgagtttggcgtgat
ggtcagaagaaagactgttttgtctaccgcttcattgcaactgggtccattgaagagaag
atcttccaacgtcaatctcacaaacagtcgctttcctcctgtgtggttgactccgctgag
gatgttgaacgacatttttcattggactcactacgtgagcttttccaattcaaaccggga
actacgagcgatacgcatgatactttcaaatgcaaaagatgcagagccgatgggactcag
tatatcaaggctccagctatgctttacggtgacaccagttcttggaatcatttcgtgaac
acgggcgagaaggggccgctcaaccagattcaagaccttttgattcgacaagagactcag
gagcgagatgtctctgcggttttccagtatatcattggtgcctacttgcaagactcccaa
agtagctatattgtctgcgttcttgcccccacgagacacgtgcggagagtaagaatggtc
gagccgccctacgtcactccacttctagctccctgccaacgcatcttcaccgattcctcc
ccacatgactttgtgacaacgcgacagcttgagaaagtcgtccgagacgccgcattcaga
ggagaccatgaagttattcagaagattgtcgatcagttatgccacgactacgcatatgca
atcattgattctgagaccggagaacttcaggagggagttgctccttatctaaaagaaatt
gtcccgccggtacttgcgtgcttctccgatcaagatgcgagggttagatactacgcttgc
gagagcatgtacaacatcgccaaggtcgcaaagggagagatattgctgtttttcaacgag
attttcgatgcgctaagcaagctagcttcagactccgaactatctgtgaagaatggagcg
gaactgctcgatcgacttgtgaaggacatcgtttccgaatcggccgcccatcacgtttcc
gtcctccagctctctgagaaacagtcctctgaccctgacgatttaggggacgacctcccg
acggcattttcgcttccgaagttcataccattgcttaaagagcgaatacacgtccttagc
gcattcactcggacgttcttggtgtcctggctgactctgttggatacaatacctgatttg
gagcttgtctcatatttaccagagttcttagcagggttgatcaaattcctgggcgatcca
aatcgagacgtcaatgttgctacacaaggtcttctcgaccggtttttggcggagatcaaa
aggattgctcgcctcaagaagggtctggcagagagtcgcaaagggcaaggaagtgacaat
agacgatcaatgacaagtgacaatattagcctagctacggacccgacaactgcccttgac
gccgagagtaatgaaaatgctgtcgaggactctgaggctgattttgctgttgaagatgaa
gaagggctccataccgatggtgactggattcctgggcaagacgtccagattgactatccg
aaaatactggatatccttgtagggtttgttgacacttcctatggtccagacgaggagatg
caattaactgcattacgctggattgatagcttttttgaaataagccccgaggatatactt
cctttcgtcccacgccttctagatcaagtcctcccagcactgtcgagcagttcaacagcc
gtgaaggagaccgcaggcagagtcaatgcgtcgctgttggagtatatcttcagcctgacc
ctatccgaggatacctcggacgactcgcgacagacctcagcctccaaactaccttctgcc
ataacgaaagagcttgctgagagaaggtcttccactccaactagtaaagccgatatatcg
ggtgtcgaatccaaaaaagcatcccctcgaaatagcgtctcgtcagctgttccttcccct
cccccagagctagattatggcgcggccgttacttctctcacgctccagtttttgagcgaa
tacgagaccacaagaatagccgctctctcttggctcatcatgctacaccgcaaggcgccg
aagaaggttgccgcattcaatgacggaatattcccagcacttcttaagacattgtctgat
ccatcagagacagttgttacgaaggaccttcaacttctatctcaaatatctaggaacagc
gaagacagctatttcaaattatttatggtgaacctgctccagctcttctctactgatagg
aacctgctggaaatccgcggaaatcttattatccgacaactctgtctaaatctgagtccc
gaacgtatatatcgaactcttgccgactgtcttgaaaaagaagatgatattgagtttgcc
agcatcatggtgcagaacttgaataataatctgattactgcgccggagctgtcagaattg
aggaagcggttacggaacttggactccagggagggccaaacgttctttgtggctcttttc
aggtcttggtgtcacaatgcagtctcgacattttccctatgtttgcttgcgcaggcgtat
gagcaggcttataatcttcttcaagtctttgctgagcttgagatgacggtcaatatgttg
attcagatagacaaactcgtccaactcctagagtctcccgttttcacctatctccgcctt
caactcctcgaacccgaaagatacccatacctgtacaaatgcctctacggcgtcctcatg
ctccttcctcaaagctcagcatttgcagctctcaagaaccgcctcaacagcgttagtaac
attggcctcctccacacaggtcctcgtctatctacaatggcttccacttctacctccggc
gcatcaacctatgaccgcaccagcggccgcctcaaacagcgtgacgaaaactccatccgc
tgggtcgatcttctagacaaattcaagtcagttcaggaaaagacccgctcttcgcagcgc
tcccagcgccccttcgacgccaacgacgcacgcacgcatcaaacgacaacactctccgct
gctatctccaacgcagatcaaatccgcagagacaagaccctccccgatacgccgcgcgcc
gcgtttggcggcgcaggaggccgcgcttcgcccgctgatggtggcaacgctggaagtgtt
gttgctggtggcgctgctgggaagggaggaattctaggtccacaacggcagaaatccggc
ttgccaaatttgggacgtttaagaattggcggggggaagaataagcgttga

DBGET integrated database retrieval system