KEGG   Aspergillus nidulans: AN5728.2
Entry
AN5728.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K21157  SNF1-activating kinase 1 [EC:2.7.11.1]
Organism
ani  Aspergillus nidulans
Pathway
ani04138  Autophagy - yeast
Brite
KEGG Orthology (KO) [BR:ani00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04138 Autophagy - yeast
    AN5728.2
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ani01001]
    AN5728.2
Enzymes [BR:ani01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AN5728.2
Protein kinases [BR:ani01001]
 Serine/threonine kinases: Other
  Other
   AN5728.2
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr APH Pkinase_fungal TCAD9 Kinase-like ABC1
Other DBs
NCBI-GeneID: 2872015
NCBI-ProteinID: XP_663332
UniProt: A0A1U8QF45 Q5B152
Position
V
AA seq 1202 aa
MADRAPSELSLEEPTDVAAPHHGQVSEYTHRRGTSKSDIAGGSQHSSIDLDAGQAVTKPS
NAKLPPSNDSLDGQPSLRHTFPHLYHSSGTSRSPSTRTSSSSLQALNEDTVVDARSERSV
FARISLSRRTSYNHQSDGGAAEYPVYPDQSYAVLQSQIHPTYQPPFLRSRSSYPIDTVHK
PTYSRGARTAGNTPISSPGLFSVRTPGLTSSPGSDGDDRSGNSYLHPSHLQPPKETHTVE
VDRDSVTGNKVINQYEILSELGRGEHGKVKLGRHVTTGQKVAIKIVQRYSKRRRLGRLGN
AEDKVKKEVAILKKARHPNVVSLLEVIDDPNRQKVYIVLEYVENGEIIWRQKGLREIVEV
DKLRLEREKIGAPDTPAFWEESKQYIMAAQRWREQRLRAMERRQAQAEHAQQGPIPAWSL
EHGAESDDELGAEIAATESHSSSSHASSAPQEAALAAMEGTMFGAYTDYPSDRRRFSTAS
SSFGYAPSETDLSPEEDDMSYVPCLTFAEARNAFRDSLLGLEYLHYQGIIHRDIKPANLL
VTSGHRVKISDFGVSYLGRPIRDEEEEQLDETDVATELDDARELSKTVGTPAFYAPELCY
TGDDFVESLGGVPRITGAIDIWSLGVTLYGMIFGRLPFVSDDEYSMYQTIVKQDVFIPRK
RLKPVQVKTSAQWPRYAPDSIRADNELVYEEVDEELWDLLKRLLTKDPVRRITLKEIKHH
PWVLHGLPNPRAWVEETDPGYLSKGKKIEVSNEEVTTAVSKVPFIQRVRSNVAKWSHYLT
GRSKDRDSRKRTPSASPSVDSTSTSSSNSHGKHHLWDGGRFSLRGDEELFSRFNRHHRDS
EHPLSQSVTVSPTASPEERPTSYLAQDGAPGYHSPANRTPRPDHPERATSNLSTAESSKT
VRASAMNKSYSVPLRPATPDLSGSSGTTNISGVIGGASHRLARGLQPGDRHFPTDFSTAE
EDHHSEPSLALSIASAVGQMQPSAWQPDGEPFTIRESRASTPEHRRKISHPLLAVEPFHL
PKEGSWHIKGSRSDPLTGLSSDREHRSGADNASRKGLDATADTGAAEYVKEGLTTSPTSA
ATMSSSSMDEDTSGMSQSTSHPSIPSVMSGASSLSEGGINKENDCDKVAQVPSILRTGET
VKARRLSTSRPPEDDESRYYCDDEEESGDDSEDEGLVFGNTRAVNKKPAIIMGKAKKGHD
AG
NT seq 3609 nt   +upstreamnt  +downstreamnt
atggccgatcgggccccttcagagctcagcctcgaggaacccacggacgtggcggcaccc
catcatgggcaggtatcggagtacacccataggaggggcacaagcaagagtgatatagcg
ggcggttctcagcactcgtcgatcgatttggacgccggccaagccgtcactaagccgtca
aacgcaaagctccctccttcgaatgactcattggatggccaaccgtctcttcgacacaca
ttcccccatctatatcactcctctggaacctcccggtcgccatccactagaacctcgtcc
agttctcttcaagcattgaacgaggataccgtggtcgatgctcggtcggaacgcagcgtc
tttgcacggatctcgctgtcgcgaaggacgtcctacaaccaccaatccgacggcggagcc
gccgaataccctgtatatcctgatcagtcctatgccgttcttcaatctcaaatacaccca
acctatcaacctccatttctacgctcccgaagctcttatcccatcgacactgttcacaaa
cctacttactcccgtggcgctcgtaccgctggcaatactcctatatccagtccaggtctg
ttctctgtccgaacccctggcctgacatcgtcgccgggatcggacggtgatgaccgttct
ggcaattcctaccttcatccgtcacatcttcagccaccaaaggagacacatactgtcgaa
gtagacagggactccgtaactggaaacaaagtcatcaaccagtatgagatcctctcagag
ctaggtcgtggcgaacatgggaaagtgaaacttggtcgccacgtgacaaccggccaaaag
gttgcgattaagattgtccagcggtactcgaaacggcggcgcttggggagactggggaat
gccgaggacaaggtcaaaaaggaggtcgccatcctgaaaaaggcccgccatccgaacgtg
gttagcctgctagaagtaatcgacgatccgaaccgccagaaggtttacatagtactcgag
tacgtcgaaaatggagagattatttggcgacaaaaaggacttcgcgagattgtggaagtt
gacaagctccgacttgaacgcgagaaaatcggtgctcctgacacaccagcattttgggaa
gagagcaagcagtacatcatggcagcgcagcgttggcgggagcaacgcttgagagcaatg
gaacggcgccaagcgcaagcagagcatgcgcagcagggacccattcctgcttggagtttg
gaacatggtgcagaatcggatgatgaactgggagctgagatcgcagcgacagagtctcat
tcctcttcgagccacgcctcttccgcgcctcaagaggctgcattggccgcaatggaaggc
accatgttcggggcctatactgattacccatctgatagacggcggttcagtaccgcatcc
agcagttttggctacgcaccttcagagacagatctgtcccctgaagaggacgacatgtcc
tatgtgccttgtttaactttcgcggaagcacgcaacgcttttcgagattcgcttctcggc
ctcgaatatctccattatcaaggaatcatacaccgcgatatcaagccggcaaaccttctg
gttaccagtggtcatcgcgtcaagatatccgatttcggtgtttcttacctgggacgacct
attcgagacgaggaggaggagcaactggatgagacagatgttgcaactgagctggacgat
gcgcgggagttgtctaaaaccgttggcacaccggctttctacgcccccgagctttgctac
actggtgacgacttcgttgaaagccttggtggcgtgccccgtatcaccggagccattgat
atctggtcccttggtgtgacgctctacgggatgatatttggtcggttgccgtttgtctcg
gatgacgagtatagcatgtatcagacgatcgtgaagcaggatgtctttattccacgcaaa
cgtctaaaacccgtccaggtgaagaccagcgcccagtggcctcgttatgcgccagatagt
attcgagcggacaacgagctggtttatgaagaagttgatgaagaattgtgggatttgttg
aaacgactactcactaaagacccggtgaggcgcatcacattaaaagagatcaagcatcat
ccatgggttcttcatggccttccgaatcctagagcttgggtggaagagaccgatcccggc
tacctaagcaagggcaagaagattgaagtttccaatgaggaagttaccactgccgtcagc
aaggtgccgtttattcaacgtgtgcggtccaatgtggcaaaatggtcgcattatttgact
ggaaggtcgaaagacagagacagtcgcaaacgcactcctagtgcaagcccctcggttgat
tcgacatccacttcgagcagcaattctcacggaaagcatcatctctgggatggtggccga
ttcagtctccgcggtgacgaagagctcttttcccggttcaaccgacatcacagggatagt
gagcatcctctctcacaaagtgtgacggtgagccctacggctagccccgaagaacggccc
acatcatatttggcccaggatggcgctcccggatatcactcccctgccaatcgaacacct
cgccctgaccatcctgagcgtgcaacgtcgaacttatcgactgccgagtcatcaaaaacc
gttagggcgtctgctatgaataagagctactctgtacctttgcgtcccgctacgcctgat
ctgtcagggtcttcgggaaccacaaacataagcggtgtcattggtggcgcgagccaccgg
ttagcaagggggcttcagccaggagatcggcattttcccaccgacttttcgaccgccgag
gaagaccatcattcggaacccagtctcgccttgagcatcgcgtccgcggttgggcagatg
cagccgtcagcatggcaaccagatggagagccgttcacaatacgcgagagccgggcatca
actcccgagcaccggcgcaagatatctcacccactcttagctgttgagcccttccatctc
cccaaggagggttcatggcacatcaaaggtagccgctcagacccacttactgggctctct
tcggaccgcgaacatcgttccggcgcggacaatgctagccgcaaggggttggatgccaca
gcggatactggtgccgcggaatatgtcaaagagggcttgacgacatcaccaacctctgca
gctaccatgtcttcctcttctatggatgaagacaccagtggtatgtcgcaaagtacatcc
catcctagcattccgtccgtcatgtcaggagcttcgtctttgtcagaaggcgggataaac
aaggagaatgattgcgacaaagtggcccaggttccttcaatccttcgtaccggtgaaacg
gtcaaagcacggcggctcagtacgtcgcgcccgccagaggatgacgaatctcgatactac
tgcgatgacgaggaggagagcggcgacgattctgaagatgaaggtctagtctttggcaat
accagagccgtcaacaaaaaaccagctatcatcatgggcaaagcgaagaaagggcacgat
gcaggctaa

DBGET integrated database retrieval system