KEGG   Aspergillus nidulans: AN5830.2Help
Entry
AN5830.2          CDS       T01016                                 

Definition
(RefSeq) hypothetical protein
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
ani  Aspergillus nidulans
Pathway
ani01100  Metabolic pathways
Brite
Enzymes [BR:ani01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     AN5830.2
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like HEPN_Swt1 PI3Ka
Motif
Other DBs
NCBI-GeneID: 2871195
NCBI-ProteinID: XP_663434
UniProt: Q5B0V0 A0A1U8QYR3
Position
I
AA seq 263 aa AA seqDB search
MSFRPQTKALFFDVFGTTVQWRKVVTKALKEASENALRSDRESLQDDIRAQASAMTEDNW
HSMAEDWRASYGRFTSTFDPSNGFVSIDQHHYDSLLEILRSRQLDELFTESELQDVVQCW
HRLEPWNDTVEGLKLLSSKFRTSTLSNGNVSLLEDLVRHASLPFTDIVSAEHFGAYKPSP
RVYLGAAEKLGFKPEECILVAAHLKDLKAAKACGFGTIYVERVGEEFGNLDHAIQEGYVD
LAVEMEDSPDGFVEVARRLGIST
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgtctttcagaccgcagaccaaagctctcttctttgatgttttcggcaccacagttcaa
tggcgcaaggtcgttacgaaagccctgaaagaagccagcgaaaacgccctccgtagcgat
cgagaatcgctccaggatgatatccgtgcacaggcatcggcaatgacagaagataattgg
cacagcatggccgaggactggcgcgcatcatacggtcgattcacatcgacgttcgatccg
tctaacggcttcgtctccatcgatcaacaccactacgactcacttcttgagattcttcgg
tctcgacagctagacgagctttttacggagagcgaactgcaagacgtcgttcagtgctgg
catagactcgagccgtggaatgataccgtggaagggctgaagctgctaagcagcaagttc
cgcacaagcacgctgtccaacggcaacgtctcacttctcgaggacctcgtgcggcatgcc
tcgcttcctttcacggatatcgtgagcgccgaacattttggcgcctacaagccgtcaccg
cgtgtatacctgggggctgctgagaagctggggttcaagcccgaggagtgtatacttgtg
gcggcgcatttgaaagatttgaaagcggccaaggcttgcggattcgggacaatctacgtt
gagcgcgttggagaagagtttggtaatctagatcacgccatccaggagggatatgtcgat
ctggccgtggagatggaagacagcccggatggcttcgtagaggttgcgagacggctgggt
atctcgacctag

DBGET integrated database retrieval system